Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5QX89

Protein Details
Accession A0A5N5QX89   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
99-123QADAARKTEKQRKKDLHFPLRKYAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAQGKVKAYELQSKSKADLVKQLGDLKEDLLKLRVQKVAGGSSAKLTKINTVRKSIARVLTVVNQKSRQNLREYYKGKKYIPLDLRPKKTLIDKPYAFQADAARKTEKQRKKDLHFPLRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.43
4 0.35
5 0.4
6 0.36
7 0.35
8 0.36
9 0.39
10 0.35
11 0.34
12 0.33
13 0.25
14 0.23
15 0.2
16 0.18
17 0.15
18 0.17
19 0.18
20 0.21
21 0.23
22 0.2
23 0.21
24 0.22
25 0.22
26 0.22
27 0.21
28 0.17
29 0.17
30 0.19
31 0.17
32 0.16
33 0.15
34 0.19
35 0.25
36 0.34
37 0.34
38 0.37
39 0.4
40 0.4
41 0.44
42 0.42
43 0.37
44 0.29
45 0.27
46 0.23
47 0.26
48 0.29
49 0.27
50 0.25
51 0.25
52 0.26
53 0.31
54 0.34
55 0.31
56 0.31
57 0.36
58 0.38
59 0.45
60 0.47
61 0.49
62 0.52
63 0.55
64 0.51
65 0.51
66 0.47
67 0.47
68 0.51
69 0.53
70 0.56
71 0.59
72 0.64
73 0.6
74 0.59
75 0.52
76 0.53
77 0.52
78 0.47
79 0.48
80 0.43
81 0.43
82 0.49
83 0.48
84 0.41
85 0.35
86 0.35
87 0.34
88 0.37
89 0.39
90 0.35
91 0.36
92 0.45
93 0.53
94 0.56
95 0.55
96 0.62
97 0.69
98 0.73
99 0.8
100 0.82
101 0.83
102 0.84
103 0.82
104 0.81
105 0.8