Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5QQJ2

Protein Details
Accession A0A5N5QQJ2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-104KPRAPAKPKEKVVKEKPKKKPTKKAAAAVSSBasic
NLS Segment(s)
PositionSequence
71-98QAAKPRAPAKPKEKVVKEKPKKKPTKKA
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPKAATTKTTKAKEPKEPKEAKEKTPSPYQLFMKEQLPVYKSKNPEVTHKDAFRAVALLWKDADENPNKGQAAKPRAPAKPKEKVVKEKPKKKPTKKAAAAVSSDAEDKDDGVSSDAEKEAADDDGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.77
4 0.8
5 0.75
6 0.77
7 0.74
8 0.7
9 0.7
10 0.65
11 0.59
12 0.62
13 0.64
14 0.58
15 0.6
16 0.56
17 0.51
18 0.5
19 0.48
20 0.4
21 0.36
22 0.33
23 0.3
24 0.29
25 0.26
26 0.28
27 0.31
28 0.32
29 0.35
30 0.4
31 0.38
32 0.45
33 0.49
34 0.5
35 0.51
36 0.49
37 0.45
38 0.39
39 0.37
40 0.28
41 0.22
42 0.15
43 0.13
44 0.12
45 0.11
46 0.1
47 0.1
48 0.11
49 0.1
50 0.14
51 0.12
52 0.15
53 0.15
54 0.18
55 0.18
56 0.18
57 0.2
58 0.23
59 0.29
60 0.3
61 0.36
62 0.39
63 0.44
64 0.49
65 0.55
66 0.55
67 0.57
68 0.6
69 0.63
70 0.64
71 0.69
72 0.74
73 0.78
74 0.81
75 0.82
76 0.86
77 0.88
78 0.92
79 0.92
80 0.92
81 0.91
82 0.92
83 0.89
84 0.86
85 0.83
86 0.77
87 0.69
88 0.6
89 0.51
90 0.41
91 0.34
92 0.25
93 0.19
94 0.13
95 0.11
96 0.1
97 0.09
98 0.09
99 0.09
100 0.1
101 0.1
102 0.12
103 0.12
104 0.11
105 0.1
106 0.11
107 0.1
108 0.11