Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q75B40

Protein Details
Accession Q75B40    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
212-240AAKRRADLPPPARKRKKPRDDYSARPKTNBasic
NLS Segment(s)
PositionSequence
213-230AKRRADLPPPARKRKKPR
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR024610  ING_N_histone-binding  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0033698  C:Rpd3L complex  
GO:0046872  F:metal ion binding  
GO:0035064  F:methylated histone binding  
GO:0006325  P:chromatin organization  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG ago:AGOS_ADL263W  -  
Pfam View protein in Pfam  
PF12998  ING  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
CDD cd15505  PHD_ING  
Amino Acid Sequences MAQKAQKHAGVANCPTRSRCSTVAIKMSTPANLFPGLNDIVDVIEEFPLEVARYMTLLREIDAKCVHTVPELNAQIGRFLAGSRQPGSPQLQTINRLFQDLMPSLEEKMHVSSIAFETLDRLVARVELAYEVALKNQEIPDKLRLGNDNHPAMHLHHELMKKIESKQQSKSQQALRSESRREAMAAKKMHVDPPAPAPASYAPLPLPPAALAAKRRADLPPPARKRKKPRDDYSARPKTNEYGEALYCYCNQVAYGEMVGCDGENCQLEWFHLPCINLETLPKGKWYCDDCKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.51
4 0.49
5 0.47
6 0.43
7 0.42
8 0.45
9 0.5
10 0.55
11 0.51
12 0.47
13 0.45
14 0.43
15 0.39
16 0.33
17 0.27
18 0.21
19 0.21
20 0.2
21 0.16
22 0.19
23 0.17
24 0.15
25 0.14
26 0.12
27 0.1
28 0.1
29 0.1
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.11
44 0.1
45 0.11
46 0.17
47 0.18
48 0.22
49 0.23
50 0.24
51 0.22
52 0.23
53 0.23
54 0.18
55 0.19
56 0.17
57 0.25
58 0.24
59 0.23
60 0.24
61 0.24
62 0.22
63 0.2
64 0.17
65 0.08
66 0.07
67 0.1
68 0.11
69 0.15
70 0.16
71 0.17
72 0.18
73 0.22
74 0.26
75 0.24
76 0.23
77 0.25
78 0.26
79 0.29
80 0.3
81 0.32
82 0.28
83 0.28
84 0.26
85 0.21
86 0.23
87 0.19
88 0.19
89 0.15
90 0.15
91 0.14
92 0.14
93 0.14
94 0.1
95 0.11
96 0.1
97 0.09
98 0.08
99 0.09
100 0.09
101 0.1
102 0.09
103 0.07
104 0.08
105 0.08
106 0.1
107 0.08
108 0.08
109 0.07
110 0.07
111 0.07
112 0.06
113 0.06
114 0.04
115 0.05
116 0.04
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.07
123 0.08
124 0.1
125 0.11
126 0.13
127 0.16
128 0.18
129 0.19
130 0.19
131 0.21
132 0.23
133 0.28
134 0.3
135 0.29
136 0.26
137 0.26
138 0.25
139 0.23
140 0.24
141 0.18
142 0.14
143 0.17
144 0.18
145 0.18
146 0.19
147 0.2
148 0.18
149 0.19
150 0.24
151 0.27
152 0.3
153 0.35
154 0.43
155 0.47
156 0.49
157 0.54
158 0.54
159 0.53
160 0.52
161 0.52
162 0.5
163 0.48
164 0.47
165 0.43
166 0.38
167 0.32
168 0.3
169 0.29
170 0.27
171 0.29
172 0.28
173 0.27
174 0.31
175 0.31
176 0.33
177 0.31
178 0.27
179 0.21
180 0.24
181 0.29
182 0.24
183 0.23
184 0.22
185 0.2
186 0.23
187 0.22
188 0.18
189 0.13
190 0.13
191 0.15
192 0.13
193 0.13
194 0.09
195 0.11
196 0.11
197 0.14
198 0.16
199 0.2
200 0.22
201 0.22
202 0.24
203 0.24
204 0.27
205 0.34
206 0.4
207 0.45
208 0.52
209 0.63
210 0.71
211 0.79
212 0.86
213 0.88
214 0.9
215 0.9
216 0.89
217 0.89
218 0.88
219 0.88
220 0.88
221 0.87
222 0.78
223 0.69
224 0.62
225 0.56
226 0.53
227 0.46
228 0.38
229 0.31
230 0.31
231 0.31
232 0.3
233 0.27
234 0.23
235 0.21
236 0.18
237 0.13
238 0.13
239 0.1
240 0.11
241 0.11
242 0.12
243 0.1
244 0.1
245 0.1
246 0.1
247 0.09
248 0.08
249 0.07
250 0.08
251 0.09
252 0.09
253 0.1
254 0.11
255 0.12
256 0.17
257 0.18
258 0.19
259 0.21
260 0.21
261 0.21
262 0.25
263 0.25
264 0.21
265 0.21
266 0.24
267 0.25
268 0.26
269 0.3
270 0.28
271 0.28
272 0.34
273 0.39