Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UDU1

Protein Details
Accession A0A179UDU1   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
44-66FRSQKNSKKPTGGKKKQERVIQGHydrophilic
NLS Segment(s)
PositionSequence
5-12KKRGKGKR
51-59KKPTGGKKK
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MVMNKKRGKGKREERGSLPCTVCVSRHWLLGYELVPLHLRVLLFRSQKNSKKPTGGKKKQERVIQGILQLGQHWTGGNGCWQQQDPGGQKPTSLVYHGVGDPVERYLRKVAWEEQRFTTNRLPSEKIMLARSGGGTGEETLDSSATLLCRNGLPFDMIFNNNSITMVIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.73
4 0.7
5 0.6
6 0.52
7 0.46
8 0.41
9 0.35
10 0.27
11 0.32
12 0.25
13 0.27
14 0.25
15 0.23
16 0.23
17 0.26
18 0.24
19 0.19
20 0.18
21 0.16
22 0.16
23 0.14
24 0.14
25 0.11
26 0.11
27 0.09
28 0.12
29 0.18
30 0.21
31 0.23
32 0.3
33 0.37
34 0.44
35 0.53
36 0.56
37 0.55
38 0.6
39 0.66
40 0.7
41 0.73
42 0.76
43 0.77
44 0.81
45 0.85
46 0.83
47 0.8
48 0.74
49 0.69
50 0.64
51 0.55
52 0.46
53 0.38
54 0.31
55 0.26
56 0.21
57 0.15
58 0.1
59 0.08
60 0.07
61 0.06
62 0.05
63 0.05
64 0.08
65 0.09
66 0.09
67 0.1
68 0.11
69 0.11
70 0.12
71 0.17
72 0.16
73 0.2
74 0.23
75 0.21
76 0.21
77 0.21
78 0.23
79 0.18
80 0.17
81 0.13
82 0.11
83 0.12
84 0.12
85 0.12
86 0.1
87 0.09
88 0.08
89 0.09
90 0.1
91 0.08
92 0.1
93 0.12
94 0.13
95 0.15
96 0.18
97 0.24
98 0.32
99 0.36
100 0.38
101 0.38
102 0.43
103 0.43
104 0.44
105 0.43
106 0.37
107 0.37
108 0.38
109 0.39
110 0.33
111 0.38
112 0.37
113 0.33
114 0.3
115 0.27
116 0.24
117 0.21
118 0.2
119 0.15
120 0.12
121 0.1
122 0.09
123 0.08
124 0.09
125 0.08
126 0.08
127 0.08
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.08
134 0.08
135 0.09
136 0.11
137 0.12
138 0.13
139 0.13
140 0.15
141 0.14
142 0.17
143 0.21
144 0.21
145 0.2
146 0.2
147 0.21
148 0.18
149 0.18