Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5QTZ9

Protein Details
Accession A0A5N5QTZ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21STPQPSKTPKGNPSPKHKAAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, mito 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Amino Acid Sequences MSTPQPSKTPKGNPSPKHKAAVPVAVKPSVYDRLAGAGGGAALAGANVLPSPINSVTNSSGTVFALISRVSVASVASIMAYLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.77
4 0.73
5 0.66
6 0.63
7 0.57
8 0.58
9 0.5
10 0.45
11 0.43
12 0.39
13 0.37
14 0.3
15 0.29
16 0.24
17 0.21
18 0.17
19 0.14
20 0.15
21 0.15
22 0.14
23 0.11
24 0.06
25 0.05
26 0.04
27 0.04
28 0.02
29 0.02
30 0.02
31 0.02
32 0.01
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.06
39 0.07
40 0.08
41 0.09
42 0.12
43 0.14
44 0.15
45 0.16
46 0.14
47 0.14
48 0.13
49 0.13
50 0.1
51 0.08
52 0.09
53 0.08
54 0.07
55 0.07
56 0.07
57 0.06
58 0.07
59 0.06
60 0.05
61 0.06
62 0.06
63 0.05