Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UBM4

Protein Details
Accession A0A179UBM4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-76KRDFKMIIISDKKKKKKKKNKKBasic
NLS Segment(s)
PositionSequence
65-76DKKKKKKKKNKK
Subcellular Location(s) nucl 15.5, cyto_nucl 13.333, mito_nucl 10.832, cyto 7
Family & Domain DBs
Amino Acid Sequences MIQNIKKVVLLSEHVNLLITEVKPETADQEMQDFEAQVNLAERKQQKPLSEKTVKRDFKMIIISDKKKKKKKKNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.15
5 0.16
6 0.12
7 0.11
8 0.11
9 0.11
10 0.11
11 0.12
12 0.12
13 0.11
14 0.12
15 0.1
16 0.12
17 0.12
18 0.12
19 0.12
20 0.1
21 0.08
22 0.07
23 0.07
24 0.05
25 0.06
26 0.06
27 0.06
28 0.12
29 0.15
30 0.16
31 0.23
32 0.26
33 0.3
34 0.35
35 0.41
36 0.46
37 0.52
38 0.54
39 0.56
40 0.63
41 0.62
42 0.57
43 0.57
44 0.48
45 0.44
46 0.46
47 0.41
48 0.4
49 0.45
50 0.51
51 0.55
52 0.64
53 0.7
54 0.74
55 0.82
56 0.84