Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5Q9V7

Protein Details
Accession A0A5N5Q9V7   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
291-327EPVYEQRRERRRPEPEREERRREERRRPVSRQQQLDEBasic
NLS Segment(s)
PositionSequence
297-318RRERRRPEPEREERRREERRRP
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MPRKSPQSKPYSTQPHSSLRQFEQKFYFPQPGHNDTQPGPHSRVFMDTLYMPETTQSRTYTAPQPTPQPAYTPRFRSSRQPMPQPPSYRSADYSVPQTPTRKTTRNADQSFNRFEAQMPTREESDPNYSPLCFQHYTPESPPTPLPGSRPATNVAGSSRTQQVPSTPAGRVGRRLERILREHTKMWEEFDHKTAERRQQQQQQQQQERLETNGVGPHRTPQRSQGRTPTLVSPTTPYAYRRGKQPHTTSESPSKSQPRVKQARGTRKDGKIFPRAAEREQVPEYEMQEPEEPVYEQRRERRRPEPEREERRREERRRPVSRQQQLDEQKLEEELAKTLKVSVIKISWEKYITNWENIMNWKSNPDKKWLEPWEIRFPTSRIKDQQDIEMLTKDEIEEFLMSESHSIGKSRKERIRADLLYWHPDKLGKWLHKFRPSSQPLIRARAGVVARHLTDLLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.67
3 0.67
4 0.67
5 0.64
6 0.59
7 0.65
8 0.59
9 0.6
10 0.57
11 0.55
12 0.54
13 0.52
14 0.55
15 0.45
16 0.52
17 0.53
18 0.53
19 0.54
20 0.52
21 0.51
22 0.43
23 0.51
24 0.47
25 0.44
26 0.42
27 0.39
28 0.38
29 0.35
30 0.37
31 0.32
32 0.27
33 0.25
34 0.22
35 0.21
36 0.21
37 0.2
38 0.16
39 0.16
40 0.17
41 0.17
42 0.2
43 0.2
44 0.2
45 0.22
46 0.27
47 0.33
48 0.38
49 0.41
50 0.41
51 0.46
52 0.5
53 0.53
54 0.49
55 0.46
56 0.47
57 0.48
58 0.53
59 0.52
60 0.52
61 0.52
62 0.54
63 0.58
64 0.59
65 0.63
66 0.63
67 0.67
68 0.71
69 0.73
70 0.79
71 0.74
72 0.69
73 0.64
74 0.6
75 0.52
76 0.46
77 0.42
78 0.37
79 0.34
80 0.35
81 0.33
82 0.33
83 0.33
84 0.35
85 0.34
86 0.38
87 0.44
88 0.45
89 0.44
90 0.5
91 0.57
92 0.64
93 0.65
94 0.64
95 0.65
96 0.65
97 0.66
98 0.59
99 0.49
100 0.39
101 0.36
102 0.37
103 0.32
104 0.32
105 0.31
106 0.31
107 0.33
108 0.33
109 0.33
110 0.29
111 0.33
112 0.28
113 0.26
114 0.25
115 0.23
116 0.23
117 0.24
118 0.26
119 0.2
120 0.18
121 0.25
122 0.27
123 0.32
124 0.33
125 0.38
126 0.33
127 0.34
128 0.34
129 0.29
130 0.29
131 0.26
132 0.27
133 0.29
134 0.32
135 0.32
136 0.33
137 0.31
138 0.3
139 0.29
140 0.27
141 0.2
142 0.19
143 0.17
144 0.18
145 0.2
146 0.19
147 0.19
148 0.19
149 0.19
150 0.19
151 0.21
152 0.22
153 0.17
154 0.22
155 0.25
156 0.26
157 0.3
158 0.32
159 0.36
160 0.36
161 0.39
162 0.38
163 0.4
164 0.43
165 0.46
166 0.46
167 0.43
168 0.42
169 0.42
170 0.41
171 0.36
172 0.34
173 0.3
174 0.28
175 0.26
176 0.26
177 0.27
178 0.23
179 0.27
180 0.3
181 0.34
182 0.38
183 0.43
184 0.48
185 0.54
186 0.63
187 0.67
188 0.7
189 0.71
190 0.7
191 0.69
192 0.63
193 0.57
194 0.49
195 0.41
196 0.34
197 0.23
198 0.18
199 0.16
200 0.15
201 0.12
202 0.12
203 0.15
204 0.21
205 0.23
206 0.23
207 0.29
208 0.39
209 0.43
210 0.46
211 0.49
212 0.48
213 0.48
214 0.49
215 0.43
216 0.35
217 0.31
218 0.29
219 0.22
220 0.18
221 0.17
222 0.17
223 0.15
224 0.2
225 0.25
226 0.27
227 0.32
228 0.39
229 0.44
230 0.51
231 0.55
232 0.55
233 0.57
234 0.58
235 0.54
236 0.55
237 0.52
238 0.46
239 0.46
240 0.44
241 0.42
242 0.46
243 0.48
244 0.49
245 0.55
246 0.57
247 0.6
248 0.63
249 0.69
250 0.67
251 0.69
252 0.67
253 0.65
254 0.67
255 0.65
256 0.62
257 0.59
258 0.55
259 0.49
260 0.49
261 0.46
262 0.41
263 0.4
264 0.35
265 0.32
266 0.3
267 0.29
268 0.21
269 0.2
270 0.21
271 0.19
272 0.18
273 0.16
274 0.16
275 0.15
276 0.15
277 0.14
278 0.12
279 0.12
280 0.17
281 0.19
282 0.22
283 0.31
284 0.41
285 0.46
286 0.53
287 0.6
288 0.66
289 0.71
290 0.78
291 0.8
292 0.81
293 0.85
294 0.88
295 0.87
296 0.83
297 0.83
298 0.83
299 0.81
300 0.81
301 0.81
302 0.82
303 0.83
304 0.84
305 0.85
306 0.85
307 0.85
308 0.81
309 0.74
310 0.73
311 0.7
312 0.68
313 0.59
314 0.49
315 0.41
316 0.34
317 0.31
318 0.23
319 0.17
320 0.13
321 0.13
322 0.12
323 0.11
324 0.12
325 0.14
326 0.13
327 0.14
328 0.15
329 0.15
330 0.19
331 0.22
332 0.24
333 0.24
334 0.24
335 0.24
336 0.22
337 0.31
338 0.3
339 0.3
340 0.29
341 0.27
342 0.28
343 0.32
344 0.35
345 0.27
346 0.25
347 0.28
348 0.34
349 0.4
350 0.39
351 0.43
352 0.46
353 0.46
354 0.55
355 0.55
356 0.57
357 0.56
358 0.6
359 0.63
360 0.59
361 0.57
362 0.51
363 0.47
364 0.48
365 0.47
366 0.49
367 0.45
368 0.49
369 0.54
370 0.53
371 0.57
372 0.52
373 0.49
374 0.43
375 0.39
376 0.33
377 0.27
378 0.25
379 0.19
380 0.15
381 0.12
382 0.11
383 0.09
384 0.08
385 0.09
386 0.09
387 0.09
388 0.09
389 0.09
390 0.1
391 0.1
392 0.12
393 0.15
394 0.24
395 0.31
396 0.41
397 0.47
398 0.53
399 0.58
400 0.63
401 0.7
402 0.64
403 0.6
404 0.6
405 0.57
406 0.57
407 0.53
408 0.46
409 0.37
410 0.37
411 0.34
412 0.34
413 0.39
414 0.39
415 0.48
416 0.58
417 0.65
418 0.72
419 0.76
420 0.73
421 0.75
422 0.72
423 0.71
424 0.68
425 0.68
426 0.65
427 0.68
428 0.63
429 0.54
430 0.48
431 0.46
432 0.42
433 0.35
434 0.34
435 0.32
436 0.31
437 0.31
438 0.31