Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5QSH3

Protein Details
Accession A0A5N5QSH3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-34AAPSGGKAAKKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
4-28AKAAAPSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPKAKAAAPSGGKAAKKKKWSKGKVKDKAQHAVTLNQATYDRIMKEVPTFKFISQSILIERLKIGGSLARVAIKHLAKEGQIKKIVHHNGQLIYTRVTTSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.55
4 0.62
5 0.67
6 0.74
7 0.81
8 0.85
9 0.86
10 0.9
11 0.9
12 0.91
13 0.88
14 0.84
15 0.82
16 0.72
17 0.67
18 0.58
19 0.51
20 0.44
21 0.39
22 0.32
23 0.24
24 0.23
25 0.17
26 0.16
27 0.15
28 0.12
29 0.11
30 0.11
31 0.11
32 0.14
33 0.2
34 0.19
35 0.21
36 0.22
37 0.21
38 0.24
39 0.23
40 0.23
41 0.17
42 0.18
43 0.15
44 0.19
45 0.19
46 0.16
47 0.16
48 0.13
49 0.12
50 0.11
51 0.11
52 0.07
53 0.08
54 0.09
55 0.1
56 0.1
57 0.1
58 0.12
59 0.18
60 0.17
61 0.17
62 0.18
63 0.19
64 0.19
65 0.29
66 0.32
67 0.33
68 0.39
69 0.39
70 0.39
71 0.47
72 0.52
73 0.47
74 0.48
75 0.45
76 0.41
77 0.44
78 0.45
79 0.37
80 0.33
81 0.3