Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UQ37

Protein Details
Accession A0A179UQ37   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-35NAYTSIHRKVKKKMQKKKNFQMFRNRRLILHydrophilic
NLS Segment(s)
PositionSequence
13-23RKVKKKMQKKK
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences KTEKNNAYTSIHRKVKKKMQKKKNFQMFRNRRLILKVSNQNILQRNKLNSNLIFRIRNEINQQFFSQLITDIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.72
3 0.75
4 0.78
5 0.79
6 0.82
7 0.87
8 0.91
9 0.93
10 0.93
11 0.91
12 0.86
13 0.87
14 0.86
15 0.83
16 0.81
17 0.71
18 0.61
19 0.55
20 0.52
21 0.46
22 0.44
23 0.42
24 0.35
25 0.38
26 0.38
27 0.4
28 0.43
29 0.41
30 0.37
31 0.34
32 0.35
33 0.35
34 0.38
35 0.37
36 0.33
37 0.36
38 0.37
39 0.38
40 0.37
41 0.35
42 0.39
43 0.36
44 0.38
45 0.39
46 0.41
47 0.41
48 0.4
49 0.41
50 0.35
51 0.33
52 0.3
53 0.23