Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UG19

Protein Details
Accession A0A179UG19    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
185-209LSLPNLTKPRKHPPREPEPPRRKTTBasic
NLS Segment(s)
PositionSequence
192-208KPRKHPPREPEPPRRKT
Subcellular Location(s) mito 19, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042103  SerRS_1_N_sf  
IPR010978  tRNA-bd_arm  
Gene Ontology GO:0000166  F:nucleotide binding  
Amino Acid Sequences MPPPPMAALRNPYVCLSCKLHNRQILSTFSQFYRSFSISLHRFSSTSAVVNTAPRPPTAPKPTPDIKHIRENAALYSQNCIDRNYHDLAQYPYEIQRLSAESHELQVALREPQRKIKQIESAIAKLRKDSSDSCNADPEEKQKQKTKVEEELSTLRLSAQHLKDQSHHLTTTRAAHAKEIERLGLSLPNLTKPRKHPPREPEPPRRKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.33
4 0.34
5 0.42
6 0.48
7 0.54
8 0.57
9 0.58
10 0.57
11 0.58
12 0.56
13 0.52
14 0.47
15 0.42
16 0.37
17 0.4
18 0.35
19 0.32
20 0.32
21 0.28
22 0.25
23 0.23
24 0.31
25 0.28
26 0.31
27 0.31
28 0.27
29 0.25
30 0.25
31 0.28
32 0.21
33 0.2
34 0.17
35 0.17
36 0.16
37 0.19
38 0.19
39 0.2
40 0.2
41 0.18
42 0.21
43 0.22
44 0.31
45 0.37
46 0.41
47 0.38
48 0.44
49 0.51
50 0.51
51 0.54
52 0.54
53 0.49
54 0.53
55 0.53
56 0.49
57 0.45
58 0.43
59 0.37
60 0.33
61 0.31
62 0.22
63 0.22
64 0.2
65 0.21
66 0.21
67 0.2
68 0.18
69 0.17
70 0.2
71 0.21
72 0.21
73 0.18
74 0.2
75 0.2
76 0.2
77 0.19
78 0.16
79 0.14
80 0.14
81 0.13
82 0.11
83 0.1
84 0.1
85 0.11
86 0.1
87 0.12
88 0.11
89 0.11
90 0.11
91 0.1
92 0.08
93 0.08
94 0.08
95 0.09
96 0.11
97 0.14
98 0.15
99 0.25
100 0.3
101 0.35
102 0.37
103 0.39
104 0.43
105 0.41
106 0.46
107 0.4
108 0.39
109 0.4
110 0.4
111 0.36
112 0.3
113 0.3
114 0.25
115 0.25
116 0.25
117 0.24
118 0.31
119 0.34
120 0.33
121 0.36
122 0.35
123 0.34
124 0.32
125 0.32
126 0.32
127 0.34
128 0.38
129 0.41
130 0.48
131 0.53
132 0.6
133 0.61
134 0.59
135 0.59
136 0.55
137 0.52
138 0.48
139 0.43
140 0.35
141 0.29
142 0.21
143 0.17
144 0.19
145 0.22
146 0.21
147 0.26
148 0.28
149 0.3
150 0.32
151 0.37
152 0.39
153 0.35
154 0.33
155 0.29
156 0.29
157 0.3
158 0.33
159 0.33
160 0.32
161 0.29
162 0.31
163 0.36
164 0.37
165 0.39
166 0.35
167 0.3
168 0.26
169 0.26
170 0.24
171 0.22
172 0.19
173 0.18
174 0.18
175 0.24
176 0.29
177 0.32
178 0.37
179 0.41
180 0.52
181 0.58
182 0.65
183 0.68
184 0.73
185 0.8
186 0.85
187 0.89
188 0.89
189 0.89