Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5QLU5

Protein Details
Accession A0A5N5QLU5   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
176-201ALTGDDKERKKKKKKRPIDPSQPSAPBasic
NLS Segment(s)
PositionSequence
182-192KERKKKKKKRP
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MTQPNAVAGPSHTGQSSAQSAQSATTAAGTGFKAFSTLEAYIAPAPAQPRPRSIIHPTQDLLGRYGILPVYDEFVRPFTTSAPGTVEDKGKRKEDGQDGPEDARHGPKEGLFQHGYKHFIKDLGLGKHNHKKDTFLADLMLNPEKPPVPILKLDRTTLIHAFRLKEGGVPGFNASALTGDDKERKKKKKKRPIDPSQPSAPTTPAAAQAAIAPGSAIRRPGGPLPPSQLASSHVPASAQQPAQRPVSQQPPQQRHPLAANPKAATRPPGTGPGAVGTTGAGMTKRKDREDAGANGHVNTTGGMGGMGGTGLKPAKKRKMCWMVRCLSHGLWVSIIGEILEYHYERMTGHYFARTRFELPLFYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.24
4 0.2
5 0.2
6 0.2
7 0.2
8 0.19
9 0.19
10 0.16
11 0.11
12 0.1
13 0.09
14 0.08
15 0.1
16 0.1
17 0.11
18 0.11
19 0.1
20 0.11
21 0.1
22 0.11
23 0.13
24 0.13
25 0.12
26 0.12
27 0.14
28 0.14
29 0.15
30 0.14
31 0.11
32 0.13
33 0.17
34 0.25
35 0.25
36 0.29
37 0.33
38 0.36
39 0.4
40 0.47
41 0.51
42 0.48
43 0.51
44 0.47
45 0.46
46 0.47
47 0.41
48 0.35
49 0.26
50 0.22
51 0.17
52 0.18
53 0.15
54 0.1
55 0.11
56 0.09
57 0.12
58 0.12
59 0.12
60 0.11
61 0.13
62 0.14
63 0.14
64 0.14
65 0.12
66 0.16
67 0.16
68 0.16
69 0.17
70 0.17
71 0.19
72 0.21
73 0.26
74 0.27
75 0.34
76 0.37
77 0.37
78 0.38
79 0.39
80 0.44
81 0.46
82 0.49
83 0.45
84 0.45
85 0.45
86 0.44
87 0.42
88 0.35
89 0.28
90 0.24
91 0.22
92 0.19
93 0.18
94 0.18
95 0.23
96 0.23
97 0.28
98 0.26
99 0.25
100 0.28
101 0.3
102 0.33
103 0.28
104 0.29
105 0.24
106 0.23
107 0.23
108 0.24
109 0.27
110 0.27
111 0.31
112 0.31
113 0.37
114 0.44
115 0.46
116 0.45
117 0.39
118 0.37
119 0.37
120 0.41
121 0.36
122 0.29
123 0.27
124 0.23
125 0.24
126 0.23
127 0.2
128 0.14
129 0.12
130 0.13
131 0.12
132 0.11
133 0.12
134 0.11
135 0.12
136 0.17
137 0.21
138 0.27
139 0.28
140 0.29
141 0.3
142 0.29
143 0.29
144 0.28
145 0.25
146 0.21
147 0.22
148 0.22
149 0.2
150 0.2
151 0.17
152 0.15
153 0.14
154 0.13
155 0.11
156 0.1
157 0.1
158 0.09
159 0.09
160 0.07
161 0.06
162 0.05
163 0.05
164 0.05
165 0.06
166 0.07
167 0.14
168 0.17
169 0.26
170 0.35
171 0.45
172 0.55
173 0.65
174 0.74
175 0.79
176 0.87
177 0.89
178 0.91
179 0.92
180 0.93
181 0.9
182 0.84
183 0.79
184 0.7
185 0.6
186 0.5
187 0.4
188 0.29
189 0.22
190 0.17
191 0.13
192 0.12
193 0.1
194 0.09
195 0.09
196 0.09
197 0.08
198 0.07
199 0.05
200 0.05
201 0.06
202 0.07
203 0.07
204 0.07
205 0.07
206 0.09
207 0.13
208 0.18
209 0.19
210 0.2
211 0.24
212 0.26
213 0.27
214 0.26
215 0.23
216 0.21
217 0.22
218 0.22
219 0.18
220 0.16
221 0.15
222 0.15
223 0.17
224 0.19
225 0.17
226 0.19
227 0.23
228 0.26
229 0.3
230 0.3
231 0.3
232 0.3
233 0.38
234 0.4
235 0.41
236 0.47
237 0.51
238 0.54
239 0.59
240 0.55
241 0.49
242 0.47
243 0.5
244 0.49
245 0.48
246 0.49
247 0.41
248 0.43
249 0.42
250 0.39
251 0.36
252 0.3
253 0.27
254 0.24
255 0.29
256 0.29
257 0.27
258 0.26
259 0.23
260 0.21
261 0.18
262 0.16
263 0.09
264 0.08
265 0.07
266 0.07
267 0.07
268 0.08
269 0.11
270 0.19
271 0.23
272 0.25
273 0.29
274 0.31
275 0.37
276 0.42
277 0.45
278 0.43
279 0.45
280 0.43
281 0.4
282 0.37
283 0.3
284 0.23
285 0.18
286 0.12
287 0.06
288 0.05
289 0.05
290 0.05
291 0.04
292 0.04
293 0.04
294 0.03
295 0.03
296 0.06
297 0.08
298 0.11
299 0.17
300 0.26
301 0.37
302 0.45
303 0.49
304 0.58
305 0.68
306 0.75
307 0.78
308 0.79
309 0.76
310 0.73
311 0.73
312 0.66
313 0.55
314 0.52
315 0.44
316 0.35
317 0.28
318 0.24
319 0.21
320 0.17
321 0.16
322 0.09
323 0.07
324 0.07
325 0.08
326 0.1
327 0.1
328 0.11
329 0.11
330 0.12
331 0.12
332 0.17
333 0.18
334 0.18
335 0.2
336 0.27
337 0.3
338 0.32
339 0.38
340 0.36
341 0.35
342 0.38
343 0.38