Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5QBH1

Protein Details
Accession A0A5N5QBH1   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-47STEKPPKVEKAKSKPKKRTTYRGGWTHydrophilic
NLS Segment(s)
PositionSequence
26-39PPKVEKAKSKPKKR
Subcellular Location(s) nucl 14.5, cyto_nucl 8.5, mito 8, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MGCTLSKAQLQSEKSADDTLQSTEKPPKVEKAKSKPKKRTTYRGGWTGGGGGGGWDGGGGADGGGCGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.25
4 0.19
5 0.18
6 0.16
7 0.16
8 0.15
9 0.16
10 0.22
11 0.24
12 0.26
13 0.26
14 0.32
15 0.37
16 0.44
17 0.51
18 0.55
19 0.64
20 0.71
21 0.79
22 0.81
23 0.84
24 0.87
25 0.85
26 0.85
27 0.82
28 0.82
29 0.78
30 0.74
31 0.67
32 0.57
33 0.49
34 0.39
35 0.31
36 0.21
37 0.14
38 0.08
39 0.05
40 0.04
41 0.04
42 0.03
43 0.03
44 0.02
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03