Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UIS8

Protein Details
Accession A0A179UIS8   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-81TERAVGDGGRRRRRRRKGSRKSHHPIISFBasic
NLS Segment(s)
PositionSequence
59-75DGGRRRRRRRKGSRKSH
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
KEGG bgh:BDBG_03245  -  
Amino Acid Sequences MGSLRPAEKSKANIRASRPSRDGTMATGPSDKTGAQGRDSGAHCSTGISFKRTERAVGDGGRRRRRRRKGSRKSHHPIISFKNSAHSSSSPSSYHRQIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.64
4 0.65
5 0.6
6 0.53
7 0.49
8 0.46
9 0.41
10 0.34
11 0.35
12 0.28
13 0.26
14 0.25
15 0.23
16 0.2
17 0.2
18 0.16
19 0.12
20 0.17
21 0.17
22 0.16
23 0.18
24 0.18
25 0.23
26 0.24
27 0.25
28 0.2
29 0.19
30 0.17
31 0.16
32 0.16
33 0.16
34 0.16
35 0.15
36 0.16
37 0.16
38 0.2
39 0.2
40 0.2
41 0.16
42 0.18
43 0.19
44 0.21
45 0.27
46 0.3
47 0.39
48 0.48
49 0.55
50 0.61
51 0.69
52 0.77
53 0.81
54 0.86
55 0.88
56 0.9
57 0.93
58 0.95
59 0.95
60 0.93
61 0.92
62 0.87
63 0.8
64 0.76
65 0.73
66 0.7
67 0.62
68 0.53
69 0.51
70 0.46
71 0.43
72 0.4
73 0.33
74 0.31
75 0.32
76 0.36
77 0.29
78 0.32
79 0.37