Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U821

Protein Details
Accession A0A179U821    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
51-70GYCSRYKSVVHKKVRKHGRKBasic
NLS Segment(s)
PositionSequence
64-67VRKH
Subcellular Location(s) nucl 14, cyto_nucl 13.833, cyto 11.5, cyto_mito 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR039024  RTC4  
IPR028094  RTC4_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
KEGG bgh:BDBG_00763  -  
Pfam View protein in Pfam  
PF14474  RTC4  
Amino Acid Sequences MCPVCNSVIEVEASSAFNAANNCMGVREQLRFYDQLTQFHPRLRRILDDSGYCSRYKSVVHKKVRKHGRKILSQSILHSTGYYDLRGHEILSAHVVSHFKDAIDSLAGIDSVASKYGTVVYAQEVLVPELLEMLVQEDMGVDAKGARWILKESNKIGNLLNLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.09
4 0.1
5 0.1
6 0.1
7 0.11
8 0.11
9 0.11
10 0.11
11 0.12
12 0.13
13 0.15
14 0.17
15 0.17
16 0.18
17 0.21
18 0.21
19 0.22
20 0.28
21 0.28
22 0.29
23 0.31
24 0.36
25 0.34
26 0.39
27 0.43
28 0.36
29 0.39
30 0.37
31 0.39
32 0.38
33 0.42
34 0.4
35 0.36
36 0.39
37 0.38
38 0.37
39 0.32
40 0.28
41 0.23
42 0.21
43 0.22
44 0.27
45 0.33
46 0.41
47 0.52
48 0.58
49 0.64
50 0.72
51 0.81
52 0.8
53 0.77
54 0.76
55 0.74
56 0.75
57 0.75
58 0.73
59 0.68
60 0.6
61 0.52
62 0.47
63 0.41
64 0.32
65 0.26
66 0.17
67 0.14
68 0.14
69 0.13
70 0.09
71 0.09
72 0.1
73 0.11
74 0.1
75 0.09
76 0.09
77 0.08
78 0.1
79 0.09
80 0.07
81 0.09
82 0.09
83 0.08
84 0.1
85 0.1
86 0.08
87 0.08
88 0.09
89 0.08
90 0.08
91 0.07
92 0.06
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.07
105 0.06
106 0.07
107 0.08
108 0.09
109 0.09
110 0.11
111 0.1
112 0.11
113 0.11
114 0.1
115 0.08
116 0.07
117 0.07
118 0.05
119 0.04
120 0.05
121 0.05
122 0.04
123 0.04
124 0.04
125 0.05
126 0.06
127 0.06
128 0.05
129 0.05
130 0.06
131 0.09
132 0.1
133 0.1
134 0.11
135 0.15
136 0.23
137 0.31
138 0.37
139 0.38
140 0.47
141 0.47
142 0.47
143 0.45