Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5Q9Y6

Protein Details
Accession A0A5N5Q9Y6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-77AEFNAKRKAKRNALASRKQFNHydrophilic
NLS Segment(s)
PositionSequence
62-68KRKAKRN
Subcellular Location(s) extr 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000627  Intradiol_dOase_C  
IPR015889  Intradiol_dOase_core  
Gene Ontology GO:0008199  F:ferric iron binding  
GO:0016702  F:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen  
GO:0006725  P:cellular aromatic compound metabolic process  
Pfam View protein in Pfam  
PF00775  Dioxygenase_C  
CDD cd03457  intradiol_dioxygenase_like  
Amino Acid Sequences MFTKTFAVAGLFAASLQLATAHPGEIHVPLPRAELQRRQLEATRRHNVARNCAPQIAEFNAKRKAKRNALASRKQFNGGRFAPRQDDTAATNTPTFPNIQNSTCVTAPEVTEGPYYVANELLRTDLREEQAGVDLILDIGVMDTTTCTPLSDALVEVWACNATGSYSGFTTAVLQIPDGSGPMQSTSMTDQFTWLRGGYATNSEGVVEFKTIYPGYYSGRTIHIHTMVHTNYNVATNGSIISHAGQVRHIGQIFFDEDLNDQVLAQSAYLNTTQTRTLNDEDSILAEENSNGYNAFAAAQLLGDDVSDGVLAYITMGVDTSFEGSITTTNYVTAAADSQSTPSAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.05
6 0.08
7 0.08
8 0.09
9 0.09
10 0.1
11 0.11
12 0.12
13 0.14
14 0.15
15 0.16
16 0.16
17 0.19
18 0.24
19 0.3
20 0.34
21 0.41
22 0.45
23 0.51
24 0.53
25 0.54
26 0.55
27 0.58
28 0.62
29 0.63
30 0.63
31 0.58
32 0.6
33 0.63
34 0.61
35 0.61
36 0.61
37 0.59
38 0.54
39 0.53
40 0.5
41 0.44
42 0.44
43 0.38
44 0.37
45 0.33
46 0.34
47 0.41
48 0.45
49 0.48
50 0.53
51 0.59
52 0.59
53 0.64
54 0.69
55 0.7
56 0.76
57 0.81
58 0.81
59 0.77
60 0.7
61 0.68
62 0.62
63 0.54
64 0.52
65 0.46
66 0.46
67 0.42
68 0.43
69 0.43
70 0.4
71 0.4
72 0.33
73 0.31
74 0.25
75 0.26
76 0.24
77 0.2
78 0.2
79 0.19
80 0.18
81 0.17
82 0.17
83 0.14
84 0.2
85 0.22
86 0.22
87 0.24
88 0.26
89 0.28
90 0.26
91 0.25
92 0.19
93 0.17
94 0.16
95 0.16
96 0.14
97 0.12
98 0.12
99 0.12
100 0.11
101 0.11
102 0.11
103 0.09
104 0.1
105 0.09
106 0.09
107 0.09
108 0.1
109 0.09
110 0.1
111 0.12
112 0.13
113 0.14
114 0.14
115 0.14
116 0.13
117 0.14
118 0.13
119 0.11
120 0.08
121 0.07
122 0.06
123 0.05
124 0.04
125 0.03
126 0.02
127 0.02
128 0.02
129 0.02
130 0.03
131 0.03
132 0.04
133 0.04
134 0.05
135 0.05
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.07
143 0.06
144 0.06
145 0.05
146 0.05
147 0.04
148 0.04
149 0.03
150 0.04
151 0.05
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.07
158 0.07
159 0.08
160 0.07
161 0.07
162 0.06
163 0.07
164 0.06
165 0.06
166 0.05
167 0.04
168 0.04
169 0.05
170 0.05
171 0.05
172 0.06
173 0.08
174 0.09
175 0.1
176 0.1
177 0.11
178 0.11
179 0.13
180 0.13
181 0.11
182 0.09
183 0.09
184 0.09
185 0.08
186 0.1
187 0.1
188 0.09
189 0.09
190 0.09
191 0.09
192 0.09
193 0.08
194 0.06
195 0.07
196 0.06
197 0.09
198 0.08
199 0.08
200 0.09
201 0.1
202 0.12
203 0.13
204 0.14
205 0.14
206 0.17
207 0.18
208 0.2
209 0.21
210 0.22
211 0.2
212 0.2
213 0.24
214 0.21
215 0.22
216 0.19
217 0.17
218 0.15
219 0.16
220 0.15
221 0.1
222 0.1
223 0.08
224 0.08
225 0.08
226 0.07
227 0.06
228 0.06
229 0.09
230 0.1
231 0.1
232 0.11
233 0.13
234 0.14
235 0.17
236 0.17
237 0.13
238 0.12
239 0.14
240 0.15
241 0.14
242 0.13
243 0.1
244 0.1
245 0.11
246 0.12
247 0.09
248 0.08
249 0.07
250 0.08
251 0.08
252 0.07
253 0.07
254 0.06
255 0.08
256 0.08
257 0.09
258 0.09
259 0.11
260 0.13
261 0.14
262 0.16
263 0.19
264 0.21
265 0.23
266 0.23
267 0.22
268 0.2
269 0.2
270 0.19
271 0.15
272 0.13
273 0.1
274 0.1
275 0.1
276 0.1
277 0.09
278 0.07
279 0.07
280 0.07
281 0.07
282 0.07
283 0.06
284 0.06
285 0.06
286 0.06
287 0.06
288 0.06
289 0.05
290 0.05
291 0.04
292 0.04
293 0.04
294 0.04
295 0.04
296 0.03
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.05
306 0.05
307 0.07
308 0.06
309 0.07
310 0.07
311 0.07
312 0.09
313 0.11
314 0.13
315 0.11
316 0.11
317 0.11
318 0.12
319 0.12
320 0.11
321 0.1
322 0.09
323 0.11
324 0.11
325 0.13
326 0.13