Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5QIG8

Protein Details
Accession A0A5N5QIG8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
211-233SDAPTARKPKYKPRPNHPGPSTTHydrophilic
NLS Segment(s)
PositionSequence
216-225ARKPKYKPRP
Subcellular Location(s) mito 14, nucl 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009027  Ribosomal_L9/RNase_H1_N  
IPR011320  RNase_H1_N  
Pfam View protein in Pfam  
PF01693  Cauli_VI  
Amino Acid Sequences MALFFAVHRGFKRGVYSDYNAFQSQVAGYGPKQSWAAFHDPKHAAEFHSTGKCPPGVEPHSASDGNPDAARVEAARLASQPAPRKAPVSDTDTEPEDDPPRRPVKSASITNALRRSVSAGIKFPNIIDAPPAPAPAPAPAPAPAPAPAPTPAHVPELVPRPPPHGTYARCESCNGTGWNITPHTLPATHVSVAVGPDRRTKRTSDAKRTVSDAPTARKPKYKPRPNHPGPSTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.39
4 0.4
5 0.41
6 0.43
7 0.38
8 0.34
9 0.29
10 0.24
11 0.2
12 0.16
13 0.13
14 0.11
15 0.11
16 0.18
17 0.18
18 0.19
19 0.2
20 0.18
21 0.2
22 0.23
23 0.31
24 0.3
25 0.31
26 0.38
27 0.39
28 0.4
29 0.41
30 0.37
31 0.3
32 0.28
33 0.29
34 0.26
35 0.29
36 0.29
37 0.27
38 0.29
39 0.28
40 0.24
41 0.24
42 0.27
43 0.25
44 0.29
45 0.31
46 0.3
47 0.33
48 0.32
49 0.31
50 0.25
51 0.24
52 0.21
53 0.17
54 0.15
55 0.12
56 0.11
57 0.12
58 0.08
59 0.07
60 0.08
61 0.08
62 0.09
63 0.09
64 0.11
65 0.13
66 0.18
67 0.24
68 0.26
69 0.28
70 0.29
71 0.3
72 0.28
73 0.3
74 0.29
75 0.29
76 0.27
77 0.26
78 0.27
79 0.26
80 0.27
81 0.23
82 0.21
83 0.19
84 0.19
85 0.18
86 0.23
87 0.25
88 0.25
89 0.25
90 0.26
91 0.3
92 0.35
93 0.37
94 0.34
95 0.38
96 0.39
97 0.42
98 0.42
99 0.35
100 0.27
101 0.24
102 0.23
103 0.19
104 0.2
105 0.17
106 0.16
107 0.17
108 0.17
109 0.17
110 0.15
111 0.14
112 0.12
113 0.1
114 0.1
115 0.09
116 0.11
117 0.11
118 0.12
119 0.09
120 0.09
121 0.1
122 0.09
123 0.1
124 0.09
125 0.1
126 0.1
127 0.11
128 0.11
129 0.12
130 0.12
131 0.12
132 0.12
133 0.13
134 0.15
135 0.15
136 0.15
137 0.17
138 0.17
139 0.18
140 0.17
141 0.16
142 0.18
143 0.23
144 0.24
145 0.26
146 0.25
147 0.27
148 0.29
149 0.3
150 0.31
151 0.32
152 0.32
153 0.35
154 0.43
155 0.42
156 0.41
157 0.41
158 0.38
159 0.33
160 0.36
161 0.31
162 0.24
163 0.22
164 0.22
165 0.25
166 0.23
167 0.21
168 0.16
169 0.16
170 0.16
171 0.15
172 0.16
173 0.16
174 0.18
175 0.18
176 0.18
177 0.17
178 0.16
179 0.17
180 0.2
181 0.2
182 0.18
183 0.27
184 0.31
185 0.35
186 0.36
187 0.39
188 0.44
189 0.51
190 0.6
191 0.62
192 0.68
193 0.69
194 0.7
195 0.71
196 0.67
197 0.58
198 0.55
199 0.49
200 0.46
201 0.5
202 0.54
203 0.54
204 0.56
205 0.6
206 0.64
207 0.7
208 0.73
209 0.74
210 0.78
211 0.85
212 0.86
213 0.91