Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5QL88

Protein Details
Accession A0A5N5QL88   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MFTWFCIWIKRRKRRAQKEALANGIEHydrophilic
NLS Segment(s)
PositionSequence
10-16KRRKRRA
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Amino Acid Sequences MFTWFCIWIKRRKRRAQKEALANGIEIGPDGWPVKPAQAIALPTLRSGNASTVSAAVGTARPEVPPPAYEAEVGKKGNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.92
3 0.93
4 0.91
5 0.91
6 0.86
7 0.8
8 0.69
9 0.58
10 0.47
11 0.36
12 0.27
13 0.16
14 0.1
15 0.05
16 0.05
17 0.06
18 0.05
19 0.06
20 0.07
21 0.08
22 0.08
23 0.08
24 0.08
25 0.09
26 0.1
27 0.11
28 0.13
29 0.12
30 0.12
31 0.12
32 0.11
33 0.1
34 0.1
35 0.1
36 0.09
37 0.1
38 0.1
39 0.09
40 0.09
41 0.08
42 0.08
43 0.07
44 0.06
45 0.07
46 0.08
47 0.08
48 0.09
49 0.1
50 0.13
51 0.14
52 0.14
53 0.16
54 0.19
55 0.19
56 0.2
57 0.21
58 0.25
59 0.29