Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6ZHC9

Protein Details
Accession A0A5N6ZHC9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-76VDHYARFRTRRPTRKAPLSPRAFTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, extr 3, E.R. 3, mito 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKSTLVFVSTFVLSLFLFEASTLVPPRLIRQVLVFAFLFSLPFLISYHATLAVDHYARFRTRRPTRKAPLSPRAFTPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.06
5 0.06
6 0.07
7 0.06
8 0.08
9 0.08
10 0.08
11 0.09
12 0.09
13 0.12
14 0.17
15 0.17
16 0.15
17 0.15
18 0.2
19 0.19
20 0.21
21 0.19
22 0.13
23 0.13
24 0.13
25 0.11
26 0.06
27 0.06
28 0.04
29 0.04
30 0.04
31 0.06
32 0.06
33 0.07
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.1
40 0.1
41 0.1
42 0.11
43 0.14
44 0.16
45 0.19
46 0.22
47 0.31
48 0.41
49 0.51
50 0.59
51 0.66
52 0.74
53 0.82
54 0.88
55 0.87
56 0.87
57 0.85
58 0.79