Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6Z1E5

Protein Details
Accession A0A5N6Z1E5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-124KRATYNPSRRVQKRRHGFLARVRTRGGRKILQRRRAMGRKSBasic
NLS Segment(s)
PositionSequence
91-123SRRVQKRRHGFLARVRTRGGRKILQRRRAMGRK
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCFRCRAMPTTLRTFSSPMSMSRYLTPNPTTTTPFRSLSPLRSMTNFTAVRPQLQSTTYTPSAASFAPQQTRSFSASASLAGKRATYNPSRRVQKRRHGFLARVRTRGGRKILQRRRAMGRKSLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.38
4 0.37
5 0.32
6 0.25
7 0.28
8 0.27
9 0.27
10 0.29
11 0.32
12 0.28
13 0.31
14 0.31
15 0.27
16 0.29
17 0.3
18 0.31
19 0.3
20 0.35
21 0.34
22 0.33
23 0.32
24 0.34
25 0.34
26 0.33
27 0.37
28 0.34
29 0.31
30 0.31
31 0.34
32 0.28
33 0.34
34 0.3
35 0.24
36 0.28
37 0.27
38 0.27
39 0.25
40 0.25
41 0.18
42 0.19
43 0.21
44 0.15
45 0.21
46 0.19
47 0.18
48 0.17
49 0.16
50 0.17
51 0.14
52 0.13
53 0.09
54 0.11
55 0.14
56 0.16
57 0.16
58 0.17
59 0.19
60 0.2
61 0.18
62 0.16
63 0.14
64 0.13
65 0.14
66 0.14
67 0.12
68 0.11
69 0.11
70 0.12
71 0.11
72 0.14
73 0.17
74 0.23
75 0.3
76 0.37
77 0.45
78 0.55
79 0.62
80 0.7
81 0.74
82 0.77
83 0.79
84 0.8
85 0.81
86 0.78
87 0.76
88 0.76
89 0.78
90 0.73
91 0.66
92 0.59
93 0.57
94 0.56
95 0.56
96 0.54
97 0.5
98 0.55
99 0.63
100 0.71
101 0.74
102 0.76
103 0.75
104 0.79
105 0.81
106 0.76
107 0.74