Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6YS89

Protein Details
Accession A0A5N6YS89   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-58DYAAGQKDPIKRKKKEKTKINTNEKEKKRKKKEKPHNSNRSVAPBasic
NLS Segment(s)
PositionSequence
23-50PIKRKKKEKTKINTNEKEKKRKKKEKPH
Subcellular Location(s) nucl 11, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MTRRLISSPNAVFLDYAAGQKDPIKRKKKEKTKINTNEKEKKRKKKEKPHNSNRSVAPPPLIISILRTPYSISSTQFSILSTPCGAFLSGPSFYSSLLATASSAMDADDSFRLFPAPVMLAGDSPLSMSAHNVMGPVRRGPIRDYAVGQFVNDVPAPMPELQLETLLSNWVMDEVRYVASVGSRNELFADWWAFAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.18
3 0.18
4 0.14
5 0.13
6 0.14
7 0.18
8 0.26
9 0.32
10 0.41
11 0.5
12 0.58
13 0.68
14 0.79
15 0.85
16 0.88
17 0.88
18 0.89
19 0.91
20 0.93
21 0.93
22 0.92
23 0.91
24 0.91
25 0.9
26 0.9
27 0.89
28 0.89
29 0.89
30 0.91
31 0.92
32 0.93
33 0.94
34 0.95
35 0.96
36 0.96
37 0.96
38 0.9
39 0.86
40 0.78
41 0.74
42 0.65
43 0.55
44 0.46
45 0.35
46 0.31
47 0.25
48 0.22
49 0.15
50 0.14
51 0.16
52 0.17
53 0.17
54 0.16
55 0.15
56 0.15
57 0.19
58 0.17
59 0.16
60 0.15
61 0.15
62 0.16
63 0.15
64 0.14
65 0.12
66 0.11
67 0.11
68 0.1
69 0.09
70 0.08
71 0.08
72 0.08
73 0.07
74 0.07
75 0.08
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.1
82 0.09
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.04
90 0.04
91 0.03
92 0.03
93 0.03
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.07
107 0.06
108 0.07
109 0.07
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.06
117 0.07
118 0.07
119 0.07
120 0.08
121 0.1
122 0.12
123 0.12
124 0.14
125 0.15
126 0.16
127 0.18
128 0.25
129 0.26
130 0.27
131 0.28
132 0.27
133 0.3
134 0.28
135 0.26
136 0.2
137 0.16
138 0.16
139 0.14
140 0.12
141 0.08
142 0.09
143 0.12
144 0.11
145 0.11
146 0.09
147 0.11
148 0.11
149 0.12
150 0.12
151 0.1
152 0.1
153 0.1
154 0.1
155 0.08
156 0.07
157 0.08
158 0.07
159 0.07
160 0.08
161 0.09
162 0.09
163 0.1
164 0.1
165 0.09
166 0.11
167 0.16
168 0.15
169 0.19
170 0.18
171 0.18
172 0.19
173 0.2
174 0.18
175 0.18
176 0.19