Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6ZDR6

Protein Details
Accession A0A5N6ZDR6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
30-60VLEHSSKMRAKWRKKRVRRLKRKRRKMRARRBasic
NLS Segment(s)
PositionSequence
36-60KMRAKWRKKRVRRLKRKRRKMRARR
Subcellular Location(s) mito 14, plas 7, cyto_mito 7, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MLSQPRRTQEARPAAALHLSFNHLLILAAVLEHSSKMRAKWRKKRVRRLKRKRRKMRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.35
4 0.26
5 0.17
6 0.16
7 0.14
8 0.13
9 0.12
10 0.09
11 0.08
12 0.07
13 0.06
14 0.04
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.06
22 0.07
23 0.1
24 0.19
25 0.29
26 0.4
27 0.51
28 0.62
29 0.71
30 0.81
31 0.9
32 0.92
33 0.94
34 0.95
35 0.96
36 0.96
37 0.96
38 0.97
39 0.97
40 0.97