Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UZH6

Protein Details
Accession A0A179UZH6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-72DGQQKMVRKRRRKPVEAQPAGHydrophilic
NLS Segment(s)
PositionSequence
59-64RKRRRK
Subcellular Location(s) extr 14, plas 5, mito 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bgh:BDBG_07798  -  
Amino Acid Sequences MPPHLHPRSRSTVSLFTLTLMSSLVIVGIPHLFPCPVPRHAYADSEMIMSADGQQKMVRKRRRKPVEAQPAGESDVNSTMINTTPPRTMKPGYSSRRQQEGLLDDDIVKFRQMEEEARNLQNVKRECPVPKPGGMVGELLGFKNQDQGRGRDGIPRADIPGRGNGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.41
3 0.33
4 0.29
5 0.25
6 0.2
7 0.13
8 0.1
9 0.07
10 0.06
11 0.05
12 0.05
13 0.04
14 0.05
15 0.06
16 0.06
17 0.06
18 0.07
19 0.07
20 0.07
21 0.13
22 0.17
23 0.2
24 0.24
25 0.26
26 0.32
27 0.33
28 0.36
29 0.32
30 0.29
31 0.26
32 0.22
33 0.19
34 0.13
35 0.11
36 0.09
37 0.1
38 0.13
39 0.12
40 0.13
41 0.14
42 0.19
43 0.28
44 0.37
45 0.44
46 0.49
47 0.58
48 0.69
49 0.77
50 0.78
51 0.79
52 0.8
53 0.82
54 0.77
55 0.7
56 0.6
57 0.51
58 0.47
59 0.39
60 0.27
61 0.17
62 0.13
63 0.12
64 0.1
65 0.09
66 0.07
67 0.07
68 0.08
69 0.08
70 0.09
71 0.11
72 0.12
73 0.14
74 0.17
75 0.18
76 0.19
77 0.25
78 0.33
79 0.35
80 0.42
81 0.48
82 0.48
83 0.53
84 0.51
85 0.46
86 0.41
87 0.38
88 0.34
89 0.27
90 0.23
91 0.18
92 0.17
93 0.18
94 0.13
95 0.11
96 0.08
97 0.07
98 0.1
99 0.11
100 0.15
101 0.17
102 0.22
103 0.26
104 0.27
105 0.28
106 0.26
107 0.27
108 0.3
109 0.29
110 0.27
111 0.27
112 0.3
113 0.31
114 0.37
115 0.43
116 0.4
117 0.4
118 0.39
119 0.37
120 0.34
121 0.32
122 0.26
123 0.18
124 0.17
125 0.16
126 0.13
127 0.13
128 0.11
129 0.1
130 0.18
131 0.18
132 0.23
133 0.26
134 0.3
135 0.33
136 0.36
137 0.37
138 0.36
139 0.39
140 0.36
141 0.36
142 0.34
143 0.34
144 0.34
145 0.36
146 0.31