Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6ZG88

Protein Details
Accession A0A5N6ZG88    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-35HNITVAFKKKPKPSRQTKPPIFPPTAHydrophilic
NLS Segment(s)
PositionSequence
17-27KKKPKPSRQTK
Subcellular Location(s) cyto_nucl 10.5, cyto 10, nucl 9, mito 6
Family & Domain DBs
Amino Acid Sequences MGDFPSTHNHNITVAFKKKPKPSRQTKPPIFPPTAEIKKRATQSNPPISPQSFYSLRQIGLVFSLIAIPTCQAPAKGPLVNGLVILTAVDDKPGPGAGPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.43
4 0.5
5 0.58
6 0.65
7 0.7
8 0.72
9 0.78
10 0.83
11 0.87
12 0.91
13 0.9
14 0.88
15 0.88
16 0.84
17 0.75
18 0.64
19 0.57
20 0.56
21 0.55
22 0.48
23 0.41
24 0.39
25 0.42
26 0.45
27 0.45
28 0.4
29 0.4
30 0.47
31 0.54
32 0.52
33 0.48
34 0.48
35 0.43
36 0.4
37 0.32
38 0.28
39 0.19
40 0.2
41 0.22
42 0.21
43 0.2
44 0.2
45 0.19
46 0.15
47 0.13
48 0.12
49 0.08
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.04
57 0.06
58 0.06
59 0.06
60 0.08
61 0.12
62 0.16
63 0.17
64 0.17
65 0.2
66 0.21
67 0.21
68 0.19
69 0.15
70 0.11
71 0.09
72 0.09
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09