Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6ZB73

Protein Details
Accession A0A5N6ZB73    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
12-41LLWKIPWRISQPQKARQRKRLRSVDKVVDTHydrophilic
78-99FDKKEKTYRKGIHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 25, mito_nucl 13.833, cyto_mito 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKVTSPLFSGLLWKIPWRISQPQKARQRKRLRSVDKVVDTINAALSRNGTKARSVDRWYREMPREEEMLPKDKYTIFDKKEKTYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.27
5 0.28
6 0.37
7 0.42
8 0.51
9 0.58
10 0.65
11 0.73
12 0.8
13 0.84
14 0.85
15 0.87
16 0.87
17 0.88
18 0.89
19 0.87
20 0.85
21 0.83
22 0.82
23 0.73
24 0.65
25 0.54
26 0.44
27 0.37
28 0.28
29 0.21
30 0.13
31 0.1
32 0.09
33 0.1
34 0.1
35 0.1
36 0.12
37 0.11
38 0.12
39 0.13
40 0.17
41 0.21
42 0.24
43 0.3
44 0.32
45 0.36
46 0.37
47 0.41
48 0.41
49 0.41
50 0.4
51 0.35
52 0.34
53 0.3
54 0.33
55 0.3
56 0.31
57 0.27
58 0.25
59 0.24
60 0.23
61 0.25
62 0.26
63 0.32
64 0.3
65 0.38
66 0.42
67 0.49
68 0.57
69 0.62
70 0.61
71 0.63
72 0.67
73 0.69
74 0.74
75 0.76
76 0.77
77 0.77
78 0.83
79 0.82
80 0.84
81 0.79
82 0.78
83 0.79
84 0.79
85 0.8
86 0.77
87 0.79