Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UFV6

Protein Details
Accession A0A179UFV6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-36CEHCHRLKREEKKTFKSQMHBasic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSFFFKYSAVLWTTKACEHCHRLKREEKKTFKSQMHFMIQNIEEAALLSEHVNLLAAEMEPETADQKMRDFEMQVDLAEEKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.27
4 0.31
5 0.37
6 0.45
7 0.51
8 0.55
9 0.59
10 0.65
11 0.72
12 0.75
13 0.79
14 0.78
15 0.77
16 0.8
17 0.81
18 0.76
19 0.7
20 0.64
21 0.6
22 0.56
23 0.5
24 0.41
25 0.37
26 0.31
27 0.28
28 0.23
29 0.16
30 0.1
31 0.09
32 0.09
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.08
52 0.08
53 0.1
54 0.12
55 0.15
56 0.16
57 0.16
58 0.18
59 0.21
60 0.21
61 0.2
62 0.2