Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75DX4

Protein Details
Accession Q75DX4    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MFERLKLRFRRCRRLRANRLADVPYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, pero 7.5, mito_nucl 7.5, nucl 6, cyto_pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001547  Glyco_hydro_5  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0009986  C:cell surface  
GO:0005576  C:extracellular region  
GO:0005758  C:mitochondrial intermembrane space  
GO:0046557  F:glucan endo-1,6-beta-glucosidase activity  
GO:0009251  P:glucan catabolic process  
GO:0044042  P:glucan metabolic process  
KEGG ago:AGOS_ABL101C  -  
Pfam View protein in Pfam  
PF00150  Cellulase  
Amino Acid Sequences MFERLKLRFRRCRRLRANRLADVPYPNPTLNSAIIFQNRHNHGVNLGSLFVLEKWIFESMFQCGGETEHAGIRKMMDAIGYEATAERLRKHYENYMAHIDWDWLQSIGVTAVRLPVGYWHINNGMYTAGFVFDDVRLVYMSARPWDYVRALIHDASRRNIGVLIDMHGLPGGANSEHHSGEGVDASFFKSGRNMDTVCNTMIPFIVQDLRGFHNVVGLQVVNEAVYDYAAEGQKYYYERAVNAVRANSVCLPVVISDGWSPDQWSKWINDRGLSNDIVIDTHVYRCYSDDDKSKSVQQLTDDLKDTVRLDRDAADFVVGEFSCVLDADSWAKTSGDRDQLIKNFGHEQVRVFNSNANVGWFFWTYQFQHGDGGEWGFVPMVHHGNLPSRPRLSIPDVENRIRQMVSNHVSFWRDKGGDRMEHWRFEEAVRRTAADILAFDRFDHSRIGRVHYWRSVRRAQYIRERGDSDLMWEWDQGFDQAISEFNKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.93
4 0.92
5 0.88
6 0.85
7 0.78
8 0.72
9 0.67
10 0.58
11 0.52
12 0.46
13 0.39
14 0.34
15 0.32
16 0.3
17 0.25
18 0.25
19 0.22
20 0.24
21 0.28
22 0.3
23 0.31
24 0.37
25 0.39
26 0.41
27 0.41
28 0.36
29 0.33
30 0.34
31 0.33
32 0.25
33 0.21
34 0.16
35 0.15
36 0.14
37 0.12
38 0.13
39 0.11
40 0.1
41 0.11
42 0.13
43 0.13
44 0.13
45 0.15
46 0.14
47 0.18
48 0.17
49 0.16
50 0.14
51 0.16
52 0.16
53 0.16
54 0.15
55 0.14
56 0.16
57 0.16
58 0.17
59 0.16
60 0.16
61 0.15
62 0.14
63 0.12
64 0.11
65 0.13
66 0.13
67 0.12
68 0.1
69 0.1
70 0.12
71 0.14
72 0.14
73 0.14
74 0.18
75 0.23
76 0.26
77 0.3
78 0.36
79 0.42
80 0.44
81 0.47
82 0.49
83 0.44
84 0.42
85 0.39
86 0.33
87 0.24
88 0.22
89 0.17
90 0.1
91 0.1
92 0.09
93 0.09
94 0.09
95 0.08
96 0.07
97 0.06
98 0.08
99 0.08
100 0.08
101 0.07
102 0.09
103 0.13
104 0.15
105 0.15
106 0.17
107 0.19
108 0.2
109 0.2
110 0.18
111 0.14
112 0.11
113 0.11
114 0.08
115 0.07
116 0.06
117 0.06
118 0.07
119 0.06
120 0.07
121 0.06
122 0.07
123 0.06
124 0.07
125 0.08
126 0.09
127 0.1
128 0.12
129 0.13
130 0.14
131 0.14
132 0.17
133 0.17
134 0.19
135 0.18
136 0.19
137 0.2
138 0.21
139 0.24
140 0.26
141 0.27
142 0.25
143 0.26
144 0.22
145 0.21
146 0.21
147 0.17
148 0.15
149 0.14
150 0.14
151 0.14
152 0.14
153 0.13
154 0.11
155 0.11
156 0.08
157 0.07
158 0.06
159 0.04
160 0.05
161 0.08
162 0.1
163 0.1
164 0.1
165 0.1
166 0.09
167 0.1
168 0.11
169 0.08
170 0.06
171 0.07
172 0.08
173 0.08
174 0.08
175 0.08
176 0.09
177 0.1
178 0.12
179 0.14
180 0.15
181 0.15
182 0.18
183 0.19
184 0.17
185 0.17
186 0.15
187 0.12
188 0.11
189 0.1
190 0.07
191 0.06
192 0.07
193 0.07
194 0.08
195 0.1
196 0.12
197 0.13
198 0.13
199 0.12
200 0.13
201 0.13
202 0.12
203 0.11
204 0.09
205 0.07
206 0.07
207 0.07
208 0.04
209 0.04
210 0.04
211 0.03
212 0.03
213 0.03
214 0.03
215 0.06
216 0.06
217 0.06
218 0.06
219 0.06
220 0.09
221 0.1
222 0.11
223 0.11
224 0.11
225 0.11
226 0.15
227 0.17
228 0.17
229 0.17
230 0.17
231 0.15
232 0.14
233 0.16
234 0.13
235 0.12
236 0.09
237 0.08
238 0.08
239 0.07
240 0.08
241 0.06
242 0.06
243 0.06
244 0.07
245 0.08
246 0.07
247 0.08
248 0.09
249 0.1
250 0.1
251 0.11
252 0.12
253 0.19
254 0.24
255 0.24
256 0.25
257 0.25
258 0.28
259 0.3
260 0.28
261 0.2
262 0.15
263 0.15
264 0.12
265 0.11
266 0.09
267 0.06
268 0.07
269 0.09
270 0.08
271 0.09
272 0.1
273 0.14
274 0.15
275 0.18
276 0.23
277 0.27
278 0.29
279 0.31
280 0.34
281 0.33
282 0.33
283 0.31
284 0.26
285 0.28
286 0.29
287 0.3
288 0.28
289 0.25
290 0.23
291 0.23
292 0.23
293 0.19
294 0.18
295 0.15
296 0.14
297 0.16
298 0.17
299 0.17
300 0.16
301 0.13
302 0.1
303 0.1
304 0.12
305 0.09
306 0.08
307 0.07
308 0.07
309 0.06
310 0.06
311 0.07
312 0.04
313 0.05
314 0.07
315 0.08
316 0.08
317 0.09
318 0.09
319 0.09
320 0.11
321 0.16
322 0.2
323 0.21
324 0.23
325 0.28
326 0.31
327 0.33
328 0.32
329 0.28
330 0.26
331 0.28
332 0.29
333 0.24
334 0.23
335 0.26
336 0.29
337 0.3
338 0.26
339 0.26
340 0.23
341 0.24
342 0.23
343 0.19
344 0.16
345 0.14
346 0.16
347 0.14
348 0.14
349 0.13
350 0.17
351 0.16
352 0.21
353 0.22
354 0.2
355 0.22
356 0.21
357 0.21
358 0.19
359 0.18
360 0.13
361 0.11
362 0.11
363 0.08
364 0.08
365 0.07
366 0.09
367 0.1
368 0.11
369 0.11
370 0.13
371 0.18
372 0.24
373 0.27
374 0.3
375 0.29
376 0.3
377 0.31
378 0.35
379 0.36
380 0.37
381 0.38
382 0.42
383 0.47
384 0.49
385 0.5
386 0.46
387 0.43
388 0.36
389 0.33
390 0.26
391 0.29
392 0.3
393 0.29
394 0.29
395 0.29
396 0.31
397 0.31
398 0.3
399 0.28
400 0.26
401 0.25
402 0.31
403 0.35
404 0.37
405 0.39
406 0.47
407 0.44
408 0.47
409 0.48
410 0.43
411 0.38
412 0.36
413 0.42
414 0.36
415 0.37
416 0.34
417 0.33
418 0.31
419 0.32
420 0.31
421 0.22
422 0.2
423 0.16
424 0.18
425 0.17
426 0.16
427 0.18
428 0.18
429 0.18
430 0.22
431 0.2
432 0.24
433 0.27
434 0.34
435 0.37
436 0.43
437 0.49
438 0.52
439 0.6
440 0.59
441 0.64
442 0.66
443 0.65
444 0.68
445 0.69
446 0.69
447 0.71
448 0.74
449 0.72
450 0.7
451 0.66
452 0.59
453 0.56
454 0.48
455 0.41
456 0.38
457 0.34
458 0.29
459 0.28
460 0.25
461 0.22
462 0.22
463 0.18
464 0.14
465 0.11
466 0.11
467 0.11
468 0.13