Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6YWY6

Protein Details
Accession A0A5N6YWY6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-96VDRPTRDRSRWQRSACHRSEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 5, cyto 3, plas 3, pero 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MALLVFVHFFACFLKSRSWSGTVHSTTQRLTGESLTQVWAVVTRNHWNQISLLKEKDKAGTKATGIYFENVPQVLCVDRPTRDRSRWQRSACHRSEMFKLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.24
4 0.28
5 0.3
6 0.29
7 0.31
8 0.37
9 0.34
10 0.36
11 0.36
12 0.34
13 0.31
14 0.34
15 0.3
16 0.22
17 0.21
18 0.17
19 0.16
20 0.15
21 0.15
22 0.12
23 0.12
24 0.1
25 0.09
26 0.09
27 0.09
28 0.09
29 0.11
30 0.15
31 0.17
32 0.2
33 0.2
34 0.19
35 0.19
36 0.21
37 0.23
38 0.21
39 0.21
40 0.2
41 0.22
42 0.22
43 0.25
44 0.26
45 0.24
46 0.25
47 0.25
48 0.23
49 0.26
50 0.26
51 0.24
52 0.2
53 0.2
54 0.18
55 0.16
56 0.18
57 0.13
58 0.13
59 0.1
60 0.1
61 0.09
62 0.09
63 0.11
64 0.12
65 0.16
66 0.2
67 0.27
68 0.34
69 0.39
70 0.49
71 0.57
72 0.64
73 0.7
74 0.71
75 0.74
76 0.77
77 0.83
78 0.76
79 0.74
80 0.66
81 0.61
82 0.63