Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6Z507

Protein Details
Accession A0A5N6Z507    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
39-68NIYTHTPRNKKNEFKKKPNSPPPRERKISQHydrophilic
NLS Segment(s)
PositionSequence
46-65RNKKNEFKKKPNSPPPRERK
Subcellular Location(s) mito 19.5, mito_nucl 13.5, nucl 6.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFMSPPHVARCSYKYHNNSLIWRKSIFYIYTILCIYMYNIYTHTPRNKKNEFKKKPNSPPPRERKISQHLINN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.58
4 0.57
5 0.62
6 0.63
7 0.62
8 0.55
9 0.5
10 0.44
11 0.38
12 0.37
13 0.29
14 0.21
15 0.19
16 0.16
17 0.18
18 0.17
19 0.15
20 0.12
21 0.11
22 0.1
23 0.08
24 0.09
25 0.07
26 0.07
27 0.09
28 0.1
29 0.15
30 0.23
31 0.29
32 0.35
33 0.43
34 0.51
35 0.6
36 0.7
37 0.77
38 0.78
39 0.82
40 0.87
41 0.89
42 0.91
43 0.92
44 0.92
45 0.91
46 0.92
47 0.91
48 0.9
49 0.86
50 0.79
51 0.78
52 0.76
53 0.77