Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZFY1

Protein Details
Accession A0A5N6ZFY1   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-28FSFRQHPSSRSSPERRKMSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001279  Metallo-B-lactamas  
IPR036866  RibonucZ/Hydroxyglut_hydro  
Gene Ontology GO:0044550  P:secondary metabolite biosynthetic process  
Pfam View protein in Pfam  
PF12706  Lactamase_B_2  
Amino Acid Sequences MRHFFRRIFSFRQHPSSRSSPERRKMSTSTMAVLYALTLSVPPLSTDPDDAKEKRHHVPGGFINPWDSYKPPPVQRILYRQLNGQANRPNTTPPTVPVQKPKFLPTRETPNLRATWLGHACYYVEYPSGLRVLFDPVFEDRCSPISWLGPKRYTEMPCDVKDIPIIDAVVISHNHYDHLSYPTVKEISKRHPNCHFFVPLGNEEWFKRSGINNVTELDWWEERDIVLSASQSTPIDKSAGDIASSPAEIKARVGCLPCQHTSNRGVFDRAKTLWASWYVESGGRKVFFAGDTGYRAVPELPDGADDHAPGCDFPTCPAFKQTGEFRGPFDLGLIPIGAYSPRFVWSPVHSDPHDAVQIFQDTKCKNALAMHWGTWVLTEEDVLEPPKKLRDALRKYDIPEEGVFDICDIGESREFESED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.65
4 0.65
5 0.66
6 0.69
7 0.69
8 0.74
9 0.81
10 0.78
11 0.76
12 0.73
13 0.71
14 0.69
15 0.61
16 0.55
17 0.47
18 0.43
19 0.36
20 0.31
21 0.22
22 0.13
23 0.1
24 0.06
25 0.05
26 0.05
27 0.06
28 0.06
29 0.07
30 0.08
31 0.12
32 0.13
33 0.17
34 0.19
35 0.22
36 0.3
37 0.3
38 0.35
39 0.4
40 0.44
41 0.47
42 0.52
43 0.53
44 0.46
45 0.53
46 0.55
47 0.55
48 0.51
49 0.45
50 0.4
51 0.36
52 0.37
53 0.31
54 0.25
55 0.21
56 0.28
57 0.35
58 0.39
59 0.44
60 0.47
61 0.52
62 0.57
63 0.61
64 0.62
65 0.62
66 0.58
67 0.54
68 0.57
69 0.58
70 0.52
71 0.5
72 0.49
73 0.44
74 0.46
75 0.44
76 0.4
77 0.35
78 0.37
79 0.32
80 0.27
81 0.33
82 0.36
83 0.4
84 0.46
85 0.48
86 0.5
87 0.51
88 0.56
89 0.55
90 0.51
91 0.54
92 0.5
93 0.55
94 0.57
95 0.6
96 0.57
97 0.54
98 0.53
99 0.47
100 0.42
101 0.33
102 0.34
103 0.31
104 0.28
105 0.22
106 0.21
107 0.21
108 0.2
109 0.19
110 0.12
111 0.09
112 0.09
113 0.09
114 0.1
115 0.11
116 0.09
117 0.09
118 0.09
119 0.13
120 0.13
121 0.13
122 0.14
123 0.14
124 0.17
125 0.17
126 0.17
127 0.13
128 0.14
129 0.15
130 0.14
131 0.14
132 0.16
133 0.23
134 0.27
135 0.32
136 0.34
137 0.35
138 0.37
139 0.42
140 0.4
141 0.37
142 0.39
143 0.39
144 0.36
145 0.4
146 0.36
147 0.3
148 0.3
149 0.26
150 0.19
151 0.14
152 0.13
153 0.08
154 0.08
155 0.08
156 0.08
157 0.07
158 0.08
159 0.08
160 0.08
161 0.08
162 0.08
163 0.09
164 0.09
165 0.12
166 0.13
167 0.13
168 0.13
169 0.15
170 0.17
171 0.16
172 0.19
173 0.2
174 0.28
175 0.38
176 0.41
177 0.44
178 0.52
179 0.56
180 0.55
181 0.54
182 0.47
183 0.36
184 0.36
185 0.33
186 0.25
187 0.22
188 0.2
189 0.17
190 0.16
191 0.17
192 0.15
193 0.12
194 0.13
195 0.12
196 0.17
197 0.19
198 0.21
199 0.2
200 0.2
201 0.21
202 0.19
203 0.19
204 0.16
205 0.13
206 0.11
207 0.1
208 0.09
209 0.08
210 0.09
211 0.09
212 0.06
213 0.06
214 0.06
215 0.07
216 0.07
217 0.08
218 0.07
219 0.07
220 0.08
221 0.08
222 0.09
223 0.07
224 0.08
225 0.1
226 0.1
227 0.1
228 0.1
229 0.1
230 0.1
231 0.1
232 0.09
233 0.07
234 0.08
235 0.07
236 0.08
237 0.08
238 0.09
239 0.12
240 0.13
241 0.14
242 0.18
243 0.23
244 0.23
245 0.25
246 0.24
247 0.26
248 0.3
249 0.31
250 0.31
251 0.28
252 0.3
253 0.3
254 0.31
255 0.32
256 0.28
257 0.26
258 0.22
259 0.22
260 0.2
261 0.2
262 0.21
263 0.16
264 0.17
265 0.16
266 0.18
267 0.18
268 0.17
269 0.18
270 0.16
271 0.15
272 0.15
273 0.14
274 0.12
275 0.12
276 0.13
277 0.11
278 0.12
279 0.14
280 0.13
281 0.12
282 0.13
283 0.12
284 0.1
285 0.1
286 0.09
287 0.07
288 0.08
289 0.09
290 0.11
291 0.11
292 0.11
293 0.1
294 0.1
295 0.1
296 0.09
297 0.09
298 0.09
299 0.09
300 0.1
301 0.16
302 0.17
303 0.19
304 0.22
305 0.23
306 0.22
307 0.27
308 0.31
309 0.32
310 0.35
311 0.34
312 0.33
313 0.34
314 0.34
315 0.28
316 0.24
317 0.18
318 0.13
319 0.13
320 0.11
321 0.07
322 0.07
323 0.07
324 0.07
325 0.06
326 0.07
327 0.07
328 0.09
329 0.1
330 0.11
331 0.15
332 0.18
333 0.25
334 0.27
335 0.33
336 0.31
337 0.35
338 0.35
339 0.35
340 0.35
341 0.28
342 0.25
343 0.22
344 0.26
345 0.24
346 0.24
347 0.27
348 0.24
349 0.26
350 0.28
351 0.25
352 0.22
353 0.25
354 0.27
355 0.28
356 0.31
357 0.3
358 0.29
359 0.29
360 0.27
361 0.24
362 0.22
363 0.15
364 0.12
365 0.11
366 0.1
367 0.11
368 0.13
369 0.15
370 0.15
371 0.15
372 0.18
373 0.24
374 0.24
375 0.26
376 0.34
377 0.42
378 0.5
379 0.58
380 0.65
381 0.64
382 0.66
383 0.7
384 0.62
385 0.55
386 0.47
387 0.41
388 0.33
389 0.3
390 0.26
391 0.19
392 0.17
393 0.13
394 0.13
395 0.1
396 0.12
397 0.14
398 0.16
399 0.18