Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZEM1

Protein Details
Accession A0A5N6ZEM1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-55QHDHDHRKTHRVHRRPWHNRKPRRSRCPCTSTWBasic
NLS Segment(s)
PositionSequence
29-46RKTHRVHRRPWHNRKPRR
Subcellular Location(s) nucl 14.5, mito_nucl 12.499, cyto_nucl 10.166, mito 8
Family & Domain DBs
Amino Acid Sequences MRISKTLNPRTSHNDLLVGKIHQHDHDHRKTHRVHRRPWHNRKPRRSRCPCTSTWDIKYYTIEGFSHGSEKTASKTYSVVGPKLSFANFAKFPRDYFKKGYVQPDFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.41
3 0.42
4 0.39
5 0.31
6 0.27
7 0.26
8 0.27
9 0.22
10 0.27
11 0.32
12 0.39
13 0.46
14 0.52
15 0.51
16 0.57
17 0.62
18 0.67
19 0.69
20 0.68
21 0.69
22 0.72
23 0.81
24 0.85
25 0.88
26 0.89
27 0.89
28 0.91
29 0.92
30 0.93
31 0.93
32 0.93
33 0.92
34 0.89
35 0.87
36 0.84
37 0.75
38 0.71
39 0.68
40 0.62
41 0.55
42 0.5
43 0.42
44 0.37
45 0.35
46 0.29
47 0.22
48 0.18
49 0.15
50 0.12
51 0.12
52 0.12
53 0.13
54 0.11
55 0.11
56 0.11
57 0.12
58 0.13
59 0.16
60 0.16
61 0.15
62 0.16
63 0.16
64 0.22
65 0.23
66 0.22
67 0.21
68 0.21
69 0.21
70 0.23
71 0.22
72 0.2
73 0.19
74 0.24
75 0.25
76 0.27
77 0.31
78 0.3
79 0.31
80 0.37
81 0.42
82 0.42
83 0.43
84 0.49
85 0.52
86 0.57
87 0.65