Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6Z7B9

Protein Details
Accession A0A5N6Z7B9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
46-65IRLVSARHWRRNQRPRPGSPHydrophilic
NLS Segment(s)
PositionSequence
79-84RPNLKR
Subcellular Location(s) nucl 10, cyto_nucl 9, mito 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MSPQGAYSLLPVIQDESRTRQGQIQGGTAPIVPKSRVSKPAISAGIRLVSARHWRRNQRPRPGSPLICELQFASKGKWRPNLKRASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.21
4 0.27
5 0.28
6 0.29
7 0.3
8 0.34
9 0.35
10 0.34
11 0.3
12 0.25
13 0.24
14 0.23
15 0.19
16 0.16
17 0.12
18 0.12
19 0.1
20 0.14
21 0.18
22 0.21
23 0.28
24 0.31
25 0.32
26 0.33
27 0.38
28 0.38
29 0.33
30 0.3
31 0.24
32 0.21
33 0.18
34 0.16
35 0.1
36 0.1
37 0.19
38 0.24
39 0.32
40 0.38
41 0.48
42 0.59
43 0.7
44 0.76
45 0.78
46 0.81
47 0.78
48 0.8
49 0.79
50 0.71
51 0.64
52 0.6
53 0.51
54 0.42
55 0.37
56 0.29
57 0.25
58 0.26
59 0.24
60 0.21
61 0.26
62 0.32
63 0.38
64 0.46
65 0.53
66 0.59
67 0.67