Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6Z253

Protein Details
Accession A0A5N6Z253   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKTTRKTKGTRVERKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
5-27KTTRKTKGTRVERKKKDPNAPKR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTRKTKGTRVERKKKDPNAPKRGLSAYMFFANENREKVREENPGISFGQVGKMLGEKWKALSDSERRPYEEKAAADKKRYEDEKASYNAAADEDEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.9
4 0.9
5 0.92
6 0.91
7 0.9
8 0.9
9 0.9
10 0.89
11 0.86
12 0.78
13 0.72
14 0.64
15 0.57
16 0.48
17 0.39
18 0.31
19 0.27
20 0.25
21 0.2
22 0.19
23 0.2
24 0.2
25 0.2
26 0.18
27 0.17
28 0.19
29 0.21
30 0.25
31 0.28
32 0.28
33 0.3
34 0.29
35 0.3
36 0.28
37 0.26
38 0.21
39 0.14
40 0.13
41 0.09
42 0.08
43 0.06
44 0.06
45 0.07
46 0.09
47 0.1
48 0.09
49 0.1
50 0.12
51 0.13
52 0.13
53 0.19
54 0.24
55 0.32
56 0.39
57 0.4
58 0.42
59 0.44
60 0.45
61 0.45
62 0.43
63 0.37
64 0.38
65 0.45
66 0.46
67 0.49
68 0.5
69 0.48
70 0.51
71 0.52
72 0.48
73 0.45
74 0.46
75 0.48
76 0.47
77 0.46
78 0.38
79 0.35
80 0.3
81 0.24
82 0.2
83 0.14