Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6YZW6

Protein Details
Accession A0A5N6YZW6   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
130-150EALVKKQKARGEKKKELDAVLHydrophilic
NLS Segment(s)
PositionSequence
134-144KKQKARGEKKK
Subcellular Location(s) nucl 15.5, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR018858  DUF2458  
Pfam View protein in Pfam  
PF10454  DUF2458  
Amino Acid Sequences MSQQYTTADLTSVLATLSALSNQQPQPYSQNTPGPEPEDNDTYEPSETIIPINPHLTPTPASQPKPHSQPQPQPPKPNPERPNTSTITAWPPALKSVMRTVSQNEDLQRKIRWLIQRQHDHEKQWWEGREALVKKQKARGEKKKELDAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.07
5 0.06
6 0.07
7 0.08
8 0.15
9 0.17
10 0.2
11 0.2
12 0.22
13 0.27
14 0.31
15 0.36
16 0.34
17 0.39
18 0.37
19 0.4
20 0.41
21 0.39
22 0.35
23 0.32
24 0.3
25 0.27
26 0.27
27 0.24
28 0.23
29 0.2
30 0.18
31 0.16
32 0.13
33 0.11
34 0.1
35 0.09
36 0.11
37 0.1
38 0.11
39 0.13
40 0.12
41 0.13
42 0.13
43 0.14
44 0.13
45 0.14
46 0.22
47 0.25
48 0.27
49 0.29
50 0.35
51 0.38
52 0.43
53 0.46
54 0.45
55 0.46
56 0.54
57 0.59
58 0.65
59 0.64
60 0.67
61 0.65
62 0.68
63 0.66
64 0.68
65 0.64
66 0.59
67 0.63
68 0.58
69 0.6
70 0.52
71 0.48
72 0.38
73 0.35
74 0.32
75 0.25
76 0.22
77 0.17
78 0.15
79 0.14
80 0.15
81 0.13
82 0.11
83 0.16
84 0.19
85 0.19
86 0.2
87 0.22
88 0.26
89 0.29
90 0.29
91 0.27
92 0.28
93 0.29
94 0.3
95 0.29
96 0.26
97 0.24
98 0.28
99 0.33
100 0.37
101 0.44
102 0.52
103 0.61
104 0.65
105 0.73
106 0.72
107 0.68
108 0.65
109 0.63
110 0.59
111 0.56
112 0.52
113 0.45
114 0.43
115 0.42
116 0.44
117 0.4
118 0.43
119 0.45
120 0.47
121 0.49
122 0.54
123 0.57
124 0.59
125 0.68
126 0.69
127 0.71
128 0.77
129 0.8
130 0.81