Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZHQ3

Protein Details
Accession A0A5N6ZHQ3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
109-131ATPGTKTKRQRTTRKGIARKIKSHydrophilic
NLS Segment(s)
PositionSequence
114-128KTKRQRTTRKGIARK
Subcellular Location(s) nucl 15.5, mito_nucl 10, cyto 6, mito 3.5, cyto_pero 3.5
Family & Domain DBs
Amino Acid Sequences MSAKSKPEGVLGLTNSEQKVLLLGILCTDESNKLDYEKLATYGGYKNIASASTTYRSAKRKLQDCQPEPTPSAEASTTNTPKRGRPSKKSQAADPPVADPEPAEKAEEATPGTKTKRQRTTRKGIARKIKSDPYDTEDAVKSESSPSKTKAVIKEEEGSDVKEESSFKEESPVKKEEKSYDECKSEDENPMSNKELDAQLGGMETPAQSAVKVEIKDDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.25
4 0.22
5 0.16
6 0.16
7 0.12
8 0.12
9 0.08
10 0.08
11 0.08
12 0.09
13 0.09
14 0.09
15 0.1
16 0.11
17 0.11
18 0.13
19 0.13
20 0.13
21 0.14
22 0.15
23 0.17
24 0.16
25 0.17
26 0.15
27 0.15
28 0.16
29 0.18
30 0.2
31 0.19
32 0.17
33 0.16
34 0.17
35 0.17
36 0.15
37 0.13
38 0.15
39 0.16
40 0.19
41 0.21
42 0.26
43 0.31
44 0.34
45 0.4
46 0.44
47 0.49
48 0.52
49 0.59
50 0.64
51 0.62
52 0.64
53 0.62
54 0.58
55 0.51
56 0.47
57 0.39
58 0.28
59 0.26
60 0.2
61 0.16
62 0.15
63 0.21
64 0.24
65 0.23
66 0.28
67 0.28
68 0.31
69 0.4
70 0.47
71 0.49
72 0.53
73 0.62
74 0.68
75 0.76
76 0.74
77 0.7
78 0.69
79 0.66
80 0.6
81 0.5
82 0.41
83 0.33
84 0.31
85 0.26
86 0.16
87 0.12
88 0.11
89 0.1
90 0.1
91 0.08
92 0.1
93 0.1
94 0.11
95 0.1
96 0.09
97 0.1
98 0.12
99 0.14
100 0.17
101 0.23
102 0.31
103 0.41
104 0.49
105 0.58
106 0.65
107 0.72
108 0.78
109 0.82
110 0.81
111 0.79
112 0.8
113 0.76
114 0.72
115 0.68
116 0.65
117 0.57
118 0.53
119 0.47
120 0.42
121 0.4
122 0.35
123 0.32
124 0.26
125 0.24
126 0.21
127 0.18
128 0.13
129 0.14
130 0.17
131 0.18
132 0.21
133 0.23
134 0.26
135 0.29
136 0.34
137 0.36
138 0.38
139 0.38
140 0.38
141 0.4
142 0.37
143 0.38
144 0.34
145 0.28
146 0.24
147 0.21
148 0.18
149 0.14
150 0.14
151 0.12
152 0.15
153 0.15
154 0.14
155 0.22
156 0.26
157 0.29
158 0.34
159 0.37
160 0.37
161 0.4
162 0.44
163 0.43
164 0.45
165 0.47
166 0.48
167 0.5
168 0.5
169 0.47
170 0.46
171 0.44
172 0.41
173 0.42
174 0.38
175 0.37
176 0.36
177 0.39
178 0.39
179 0.35
180 0.31
181 0.27
182 0.25
183 0.2
184 0.18
185 0.15
186 0.12
187 0.12
188 0.11
189 0.08
190 0.07
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.08
197 0.13
198 0.18
199 0.18