Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZFU5

Protein Details
Accession A0A5N6ZFU5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-88LGAGGKPRMRRTRKTFPGPASHydrophilic
NLS Segment(s)
PositionSequence
73-78KPRMRR
Subcellular Location(s) mito 12.5, mito_nucl 11, nucl 8.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MVTGKSQGAEPFHSLPPTTTQPKFVAASPPSKRDLASWWRQFKRNTRKEEPKGACVCSMEAHSRLPALGAGGKPRMRRTRKTFPGPASMLEVEFRLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.27
4 0.31
5 0.33
6 0.3
7 0.32
8 0.32
9 0.35
10 0.35
11 0.32
12 0.33
13 0.29
14 0.37
15 0.37
16 0.39
17 0.38
18 0.37
19 0.36
20 0.28
21 0.33
22 0.32
23 0.38
24 0.43
25 0.49
26 0.52
27 0.58
28 0.61
29 0.65
30 0.68
31 0.66
32 0.67
33 0.67
34 0.74
35 0.74
36 0.79
37 0.72
38 0.68
39 0.63
40 0.56
41 0.47
42 0.37
43 0.32
44 0.23
45 0.22
46 0.16
47 0.15
48 0.14
49 0.13
50 0.13
51 0.12
52 0.11
53 0.09
54 0.08
55 0.09
56 0.09
57 0.12
58 0.18
59 0.21
60 0.24
61 0.33
62 0.42
63 0.46
64 0.55
65 0.61
66 0.67
67 0.74
68 0.81
69 0.81
70 0.76
71 0.78
72 0.7
73 0.63
74 0.57
75 0.48
76 0.39
77 0.31