Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6YTX7

Protein Details
Accession A0A5N6YTX7   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
131-152QSWVLAPVVKKRRRRVNGNGVVHydrophilic
NLS Segment(s)
PositionSequence
141-144KRRR
Subcellular Location(s) cyto 11, nucl 8, mito 6
Family & Domain DBs
Amino Acid Sequences MEQWGGVKGWEVVLRKREEERLRGGMQISCGRENEGGGIVSNAWDTDVIVSSASSSGGGEGGSMLRGRRKPVVVSSPVPAWLLMEVGRGRSFADLRGLVCRVRGYLDALRERGVPGDRIVFPDIELLPVFQSWVLAPVVKKRRRRVNGNGVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.39
4 0.46
5 0.48
6 0.5
7 0.51
8 0.51
9 0.48
10 0.47
11 0.45
12 0.38
13 0.36
14 0.35
15 0.32
16 0.27
17 0.26
18 0.26
19 0.24
20 0.23
21 0.2
22 0.15
23 0.12
24 0.1
25 0.1
26 0.08
27 0.08
28 0.07
29 0.06
30 0.05
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.1
53 0.11
54 0.14
55 0.17
56 0.19
57 0.2
58 0.24
59 0.29
60 0.29
61 0.29
62 0.28
63 0.26
64 0.25
65 0.23
66 0.19
67 0.13
68 0.08
69 0.07
70 0.05
71 0.08
72 0.07
73 0.08
74 0.08
75 0.08
76 0.09
77 0.1
78 0.1
79 0.08
80 0.12
81 0.12
82 0.12
83 0.15
84 0.16
85 0.14
86 0.15
87 0.14
88 0.11
89 0.12
90 0.12
91 0.14
92 0.17
93 0.23
94 0.25
95 0.26
96 0.26
97 0.25
98 0.25
99 0.23
100 0.22
101 0.17
102 0.15
103 0.19
104 0.18
105 0.21
106 0.22
107 0.19
108 0.18
109 0.2
110 0.18
111 0.15
112 0.15
113 0.12
114 0.11
115 0.11
116 0.11
117 0.07
118 0.08
119 0.06
120 0.08
121 0.09
122 0.1
123 0.12
124 0.21
125 0.32
126 0.39
127 0.48
128 0.56
129 0.66
130 0.73
131 0.81
132 0.83