Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6ZA54

Protein Details
Accession A0A5N6ZA54    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
204-234ADELGSIVRKQKKKRTKKPRLLRRASTTDAEHydrophilic
NLS Segment(s)
PositionSequence
212-227RKQKKKRTKKPRLLRR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022793  Rrn10  
Gene Ontology GO:0006360  P:transcription by RNA polymerase I  
Amino Acid Sequences MSYGKSLALSQNSFLQPPEDEDGHSAEPSIRRQKRQATVYDAVAGRIDAHGFLPLVPFASRYRDTASSNSRPVRPEEVLFRRQNAPIRYEENDFYFAHESLPPNRPLPSSDLLEAIHAYSADYYDYATADHGHDDYQSMDETALIAMGILMEEMAKESLGETGDLVLVEGEEIRSEADRSESRGRSVGRKRANTGRSSIMASSADELGSIVRKQKKKRTKKPRLLRRASTTDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.21
4 0.24
5 0.27
6 0.21
7 0.2
8 0.21
9 0.25
10 0.24
11 0.23
12 0.19
13 0.17
14 0.2
15 0.27
16 0.36
17 0.39
18 0.43
19 0.51
20 0.6
21 0.66
22 0.69
23 0.67
24 0.65
25 0.62
26 0.58
27 0.56
28 0.47
29 0.39
30 0.32
31 0.25
32 0.17
33 0.14
34 0.12
35 0.07
36 0.07
37 0.08
38 0.07
39 0.07
40 0.08
41 0.07
42 0.08
43 0.08
44 0.1
45 0.1
46 0.16
47 0.17
48 0.18
49 0.22
50 0.24
51 0.27
52 0.32
53 0.39
54 0.38
55 0.44
56 0.46
57 0.45
58 0.43
59 0.44
60 0.43
61 0.37
62 0.34
63 0.36
64 0.39
65 0.44
66 0.44
67 0.43
68 0.4
69 0.42
70 0.46
71 0.39
72 0.35
73 0.31
74 0.33
75 0.33
76 0.33
77 0.31
78 0.26
79 0.27
80 0.23
81 0.22
82 0.2
83 0.18
84 0.16
85 0.17
86 0.16
87 0.18
88 0.22
89 0.21
90 0.2
91 0.21
92 0.21
93 0.2
94 0.23
95 0.22
96 0.19
97 0.18
98 0.18
99 0.17
100 0.17
101 0.15
102 0.11
103 0.07
104 0.06
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.05
117 0.06
118 0.06
119 0.06
120 0.06
121 0.07
122 0.07
123 0.07
124 0.07
125 0.06
126 0.06
127 0.06
128 0.06
129 0.05
130 0.04
131 0.03
132 0.03
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.05
146 0.06
147 0.06
148 0.05
149 0.05
150 0.06
151 0.06
152 0.06
153 0.04
154 0.04
155 0.04
156 0.04
157 0.03
158 0.03
159 0.03
160 0.04
161 0.05
162 0.06
163 0.06
164 0.11
165 0.12
166 0.18
167 0.26
168 0.27
169 0.28
170 0.33
171 0.35
172 0.4
173 0.48
174 0.52
175 0.53
176 0.57
177 0.61
178 0.66
179 0.7
180 0.63
181 0.59
182 0.54
183 0.47
184 0.44
185 0.39
186 0.32
187 0.26
188 0.23
189 0.21
190 0.16
191 0.14
192 0.11
193 0.11
194 0.09
195 0.11
196 0.12
197 0.18
198 0.26
199 0.34
200 0.43
201 0.54
202 0.64
203 0.73
204 0.83
205 0.87
206 0.89
207 0.93
208 0.95
209 0.96
210 0.96
211 0.95
212 0.94
213 0.91
214 0.88