Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6ZDP1

Protein Details
Accession A0A5N6ZDP1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGIIRKKNKKKKSNFILAVWHydrophilic
NLS Segment(s)
PositionSequence
5-12RKKNKKKK
Subcellular Location(s) mito 18, nucl 4, plas 2, cyto 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MGIIRKKNKKKKSNFILAVWSIWSCRWSFFLQDRRMRPRLPFTLQPREQTLLSGRCLAVQSSQDSSSMSLTVILHAFAKSGCLLYLVYALKTDTAESLSGRQILES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.8
3 0.77
4 0.68
5 0.58
6 0.48
7 0.38
8 0.27
9 0.22
10 0.19
11 0.12
12 0.11
13 0.13
14 0.14
15 0.18
16 0.26
17 0.34
18 0.42
19 0.49
20 0.55
21 0.6
22 0.62
23 0.59
24 0.55
25 0.54
26 0.52
27 0.49
28 0.5
29 0.49
30 0.56
31 0.56
32 0.55
33 0.5
34 0.46
35 0.4
36 0.34
37 0.31
38 0.23
39 0.21
40 0.2
41 0.17
42 0.15
43 0.16
44 0.15
45 0.12
46 0.11
47 0.12
48 0.13
49 0.13
50 0.12
51 0.12
52 0.13
53 0.12
54 0.1
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.06
65 0.07
66 0.07
67 0.07
68 0.06
69 0.07
70 0.07
71 0.07
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.12
78 0.13
79 0.13
80 0.09
81 0.1
82 0.11
83 0.11
84 0.14
85 0.16
86 0.18