Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UQC8

Protein Details
Accession A0A179UQC8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
30-51AATHHRVPRRARPDRRKFSFFPBasic
NLS Segment(s)
PositionSequence
37-45PRRARPDRR
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_mito 11.833
Family & Domain DBs
Amino Acid Sequences MGSKSIVIYKGKGNKINKSTSMPFAAAPAAATHHRVPRRARPDRRKFSFFPFFLSFVQGTNCFKSELDMAKKRLTKNFPSLEFPYYPGGLYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.64
4 0.6
5 0.58
6 0.55
7 0.51
8 0.49
9 0.4
10 0.34
11 0.28
12 0.25
13 0.17
14 0.14
15 0.1
16 0.09
17 0.09
18 0.12
19 0.13
20 0.2
21 0.22
22 0.27
23 0.32
24 0.39
25 0.49
26 0.56
27 0.65
28 0.7
29 0.78
30 0.83
31 0.85
32 0.81
33 0.73
34 0.71
35 0.69
36 0.58
37 0.53
38 0.45
39 0.41
40 0.35
41 0.35
42 0.27
43 0.19
44 0.2
45 0.16
46 0.16
47 0.15
48 0.16
49 0.14
50 0.14
51 0.15
52 0.17
53 0.22
54 0.29
55 0.34
56 0.37
57 0.43
58 0.48
59 0.5
60 0.54
61 0.54
62 0.53
63 0.56
64 0.61
65 0.57
66 0.6
67 0.6
68 0.56
69 0.5
70 0.45
71 0.39
72 0.32