Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6ZDG1

Protein Details
Accession A0A5N6ZDG1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
114-146AIKADRARKKKASKMKKSRRKYRNLEEGRKEPQBasic
NLS Segment(s)
PositionSequence
115-137IKADRARKKKASKMKKSRRKYRN
Subcellular Location(s) mito 17, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MLLRTLIPRNFASHSQPVALLRCFTITSHLTEKPLPPRLKINDADLTVSYLKGSGPGGQKINKTSSAVQLIHKPTGLVVKSQATRSRSQNEKIARQLLADKIEHLEKGEQSRTAIKADRARKKKASKMKKSRRKYRNLEEGRKEPQEQEPCDEKAYQEPVGEESPKAVLESPVEWKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.34
4 0.34
5 0.34
6 0.32
7 0.26
8 0.2
9 0.2
10 0.19
11 0.17
12 0.2
13 0.17
14 0.2
15 0.24
16 0.26
17 0.27
18 0.29
19 0.34
20 0.36
21 0.44
22 0.41
23 0.39
24 0.46
25 0.49
26 0.53
27 0.5
28 0.48
29 0.44
30 0.43
31 0.42
32 0.33
33 0.31
34 0.24
35 0.22
36 0.16
37 0.11
38 0.1
39 0.09
40 0.09
41 0.11
42 0.14
43 0.18
44 0.21
45 0.25
46 0.27
47 0.29
48 0.31
49 0.28
50 0.27
51 0.25
52 0.26
53 0.28
54 0.27
55 0.26
56 0.29
57 0.3
58 0.28
59 0.27
60 0.22
61 0.17
62 0.21
63 0.19
64 0.13
65 0.13
66 0.16
67 0.18
68 0.21
69 0.25
70 0.23
71 0.26
72 0.3
73 0.35
74 0.36
75 0.36
76 0.4
77 0.4
78 0.42
79 0.41
80 0.4
81 0.33
82 0.29
83 0.29
84 0.25
85 0.23
86 0.19
87 0.16
88 0.14
89 0.15
90 0.14
91 0.13
92 0.12
93 0.11
94 0.15
95 0.16
96 0.15
97 0.16
98 0.19
99 0.2
100 0.21
101 0.22
102 0.23
103 0.29
104 0.38
105 0.47
106 0.5
107 0.56
108 0.62
109 0.68
110 0.72
111 0.75
112 0.77
113 0.78
114 0.83
115 0.87
116 0.89
117 0.92
118 0.93
119 0.93
120 0.92
121 0.91
122 0.9
123 0.9
124 0.9
125 0.89
126 0.86
127 0.83
128 0.79
129 0.73
130 0.65
131 0.56
132 0.55
133 0.53
134 0.48
135 0.48
136 0.47
137 0.44
138 0.45
139 0.42
140 0.34
141 0.32
142 0.34
143 0.29
144 0.25
145 0.24
146 0.25
147 0.28
148 0.28
149 0.22
150 0.19
151 0.18
152 0.17
153 0.17
154 0.15
155 0.13
156 0.14
157 0.17