Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6YTQ5

Protein Details
Accession A0A5N6YTQ5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
49-78GIMTWLTKKENKKEKKKGIKRTKPKTKKRGBasic
NLS Segment(s)
PositionSequence
56-78KKENKKEKKKGIKRTKPKTKKRG
Subcellular Location(s) mito 8, plas 7, mito_nucl 7, nucl 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTIWDLLTGSEGALNGSIRIRTRNRYWVGSSFRVTFCKLACSRVLILLGIMTWLTKKENKKEKKKGIKRTKPKTKKRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.11
5 0.11
6 0.18
7 0.22
8 0.27
9 0.31
10 0.4
11 0.43
12 0.45
13 0.47
14 0.48
15 0.51
16 0.48
17 0.46
18 0.39
19 0.37
20 0.35
21 0.32
22 0.26
23 0.2
24 0.23
25 0.21
26 0.2
27 0.19
28 0.2
29 0.19
30 0.19
31 0.19
32 0.12
33 0.11
34 0.09
35 0.08
36 0.06
37 0.05
38 0.04
39 0.03
40 0.05
41 0.07
42 0.13
43 0.2
44 0.3
45 0.41
46 0.51
47 0.62
48 0.73
49 0.81
50 0.87
51 0.91
52 0.92
53 0.94
54 0.94
55 0.94
56 0.95
57 0.95
58 0.95