Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6YUE6

Protein Details
Accession A0A5N6YUE6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68TCGYCGRRRRGTMRTRRSRIHydrophilic
NLS Segment(s)
PositionSequence
56-65RRRGTMRTRR
Subcellular Location(s) plas 13, vacu 5, mito 4, pero 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAVVSCIQSVFHAIGACLMGIVNTIGSLCKAIIDGVVTILDVIISCLTCGYCGRRRRGTMRTRRSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.09
5 0.07
6 0.06
7 0.04
8 0.04
9 0.04
10 0.03
11 0.03
12 0.03
13 0.03
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.05
37 0.07
38 0.13
39 0.21
40 0.28
41 0.36
42 0.44
43 0.51
44 0.58
45 0.67
46 0.71
47 0.75
48 0.79