Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZFN6

Protein Details
Accession A0A5N6ZFN6   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-106KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 12.833, nucl 6, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MALFRTITGPATGLFRQILRKPLRGGFLSRSFSQLASLSLRSLRTGKQQAGSVSVASTVRQLDQTRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.22
4 0.25
5 0.33
6 0.34
7 0.38
8 0.41
9 0.43
10 0.46
11 0.42
12 0.43
13 0.41
14 0.43
15 0.42
16 0.39
17 0.38
18 0.33
19 0.31
20 0.28
21 0.22
22 0.17
23 0.15
24 0.15
25 0.13
26 0.14
27 0.14
28 0.14
29 0.15
30 0.15
31 0.2
32 0.24
33 0.25
34 0.26
35 0.28
36 0.27
37 0.28
38 0.27
39 0.19
40 0.15
41 0.14
42 0.12
43 0.09
44 0.1
45 0.07
46 0.07
47 0.1
48 0.11
49 0.12
50 0.2
51 0.23
52 0.25
53 0.28
54 0.29
55 0.27
56 0.29
57 0.37
58 0.37
59 0.41
60 0.41
61 0.42
62 0.49
63 0.52
64 0.53
65 0.51
66 0.52
67 0.54
68 0.59
69 0.64
70 0.65
71 0.72
72 0.77
73 0.76
74 0.79
75 0.8
76 0.79
77 0.77
78 0.78
79 0.76
80 0.77
81 0.79
82 0.75
83 0.75
84 0.77
85 0.81
86 0.82