Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UDJ6

Protein Details
Accession A0A179UDJ6    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-36NLSRRRSTSSTSSRRRSRSRDRYSTISSHydrophilic
NLS Segment(s)
PositionSequence
73-91RRAKPRSGFIARTVRKIRR
Subcellular Location(s) plas 10, mito 8, nucl 4, pero 2, cyto 1, extr 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDWLYPFSNLSRRRSTSSTSSRRRSRSRDRYSTISSRHSGSHSRSKSHSSPSLFNLGGHANRSTASAASSSSRRAKPRSGFIARTVRKIRRLFRHILRYARSHPLKVFFMVVMPLITGGVLQKLLSVVGVRLPPLLGGGHGAGFRGGNGGVGGGGLGGMLGGGGGGLGGSVGGLMSLAKMFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.57
4 0.62
5 0.66
6 0.67
7 0.73
8 0.75
9 0.81
10 0.84
11 0.83
12 0.84
13 0.84
14 0.85
15 0.85
16 0.82
17 0.81
18 0.79
19 0.78
20 0.72
21 0.66
22 0.58
23 0.49
24 0.46
25 0.42
26 0.4
27 0.38
28 0.43
29 0.4
30 0.42
31 0.44
32 0.48
33 0.49
34 0.5
35 0.51
36 0.45
37 0.45
38 0.44
39 0.46
40 0.4
41 0.35
42 0.3
43 0.26
44 0.23
45 0.21
46 0.18
47 0.13
48 0.13
49 0.14
50 0.12
51 0.1
52 0.09
53 0.08
54 0.08
55 0.1
56 0.11
57 0.14
58 0.2
59 0.25
60 0.28
61 0.31
62 0.38
63 0.4
64 0.46
65 0.51
66 0.5
67 0.48
68 0.5
69 0.57
70 0.51
71 0.53
72 0.52
73 0.47
74 0.5
75 0.54
76 0.54
77 0.53
78 0.57
79 0.57
80 0.58
81 0.64
82 0.6
83 0.6
84 0.56
85 0.51
86 0.49
87 0.52
88 0.46
89 0.38
90 0.35
91 0.34
92 0.32
93 0.29
94 0.26
95 0.16
96 0.15
97 0.13
98 0.12
99 0.07
100 0.06
101 0.05
102 0.04
103 0.04
104 0.04
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.04
115 0.07
116 0.08
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.05
124 0.06
125 0.06
126 0.07
127 0.07
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.06
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.04
140 0.03
141 0.03
142 0.02
143 0.02
144 0.02
145 0.02
146 0.01
147 0.01
148 0.01
149 0.01
150 0.01
151 0.01
152 0.01
153 0.01
154 0.01
155 0.01
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.03