Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6Z953

Protein Details
Accession A0A5N6Z953   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
43-69ELNPSQPQHHRPPKRKKTTTGGRNRPSHydrophilic
NLS Segment(s)
PositionSequence
52-89HRPPKRKKTTTGGRNRPSTAIGRTLRRFFQHARRGLRR
Subcellular Location(s) nucl 14.5, cyto_nucl 8.5, extr 5, mito 4
Family & Domain DBs
Amino Acid Sequences MNTLREHPNVHVNFPPLICSILGVQSPVPPISPNQPHHSQPNELNPSQPQHHRPPKRKKTTTGGRNRPSTAIGRTLRRFFQHARRGLRRLGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.22
4 0.22
5 0.18
6 0.15
7 0.13
8 0.13
9 0.13
10 0.11
11 0.11
12 0.11
13 0.13
14 0.12
15 0.11
16 0.09
17 0.11
18 0.18
19 0.25
20 0.27
21 0.32
22 0.36
23 0.38
24 0.43
25 0.44
26 0.4
27 0.36
28 0.42
29 0.41
30 0.37
31 0.36
32 0.32
33 0.32
34 0.31
35 0.32
36 0.28
37 0.33
38 0.43
39 0.52
40 0.61
41 0.69
42 0.77
43 0.84
44 0.85
45 0.82
46 0.82
47 0.83
48 0.83
49 0.83
50 0.83
51 0.79
52 0.77
53 0.72
54 0.63
55 0.56
56 0.49
57 0.41
58 0.4
59 0.37
60 0.4
61 0.44
62 0.46
63 0.47
64 0.46
65 0.49
66 0.47
67 0.53
68 0.54
69 0.57
70 0.63
71 0.68
72 0.69