Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6YSK6

Protein Details
Accession A0A5N6YSK6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MIRRLNHRERIRRDRMKVIVBasic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIRRLNHRERIRRDRMKVIVLSRIVTRAVVDAYLALWVPVHQWRRNLEVQEHSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.71
4 0.65
5 0.57
6 0.53
7 0.44
8 0.39
9 0.31
10 0.27
11 0.22
12 0.17
13 0.14
14 0.09
15 0.08
16 0.06
17 0.06
18 0.04
19 0.04
20 0.05
21 0.04
22 0.04
23 0.03
24 0.04
25 0.06
26 0.12
27 0.18
28 0.21
29 0.26
30 0.3
31 0.36
32 0.42
33 0.45
34 0.44
35 0.47