Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6YWD1

Protein Details
Accession A0A5N6YWD1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-61RDSERVRKKCWKKIPLGRQRQDVSHydrophilic
NLS Segment(s)
PositionSequence
42-46RVRKK
Subcellular Location(s) cyto 14, nucl 7, cyto_pero 7
Family & Domain DBs
Amino Acid Sequences MFSVKGGGAGETVCAVSLASSVSGRGGSPAPKKESVGRDSERVRKKCWKKIPLGRQRQDVSFDAATKVRREP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.06
10 0.06
11 0.06
12 0.07
13 0.08
14 0.13
15 0.18
16 0.23
17 0.26
18 0.27
19 0.29
20 0.33
21 0.37
22 0.34
23 0.36
24 0.33
25 0.34
26 0.38
27 0.45
28 0.49
29 0.46
30 0.49
31 0.53
32 0.6
33 0.65
34 0.71
35 0.71
36 0.72
37 0.8
38 0.85
39 0.86
40 0.88
41 0.84
42 0.83
43 0.77
44 0.69
45 0.64
46 0.55
47 0.5
48 0.41
49 0.36
50 0.3
51 0.3
52 0.31