Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6Z1R3

Protein Details
Accession A0A5N6Z1R3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
187-219IRGMSRAERKDRIRRNERKMRANQRNSRKSGGGBasic
NLS Segment(s)
PositionSequence
100-139KPLPTPKPPTKWELFARKKGIGRFSGKAGAGLEDKERRKK
183-219KGSSIRGMSRAERKDRIRRNERKMRANQRNSRKSGGG
Subcellular Location(s) mito 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSAVETTIAASAATKSKPERLPITVSKPTPYTFDLGHLLANDPNPLEISRSAVNDSLKNTARDGVQSLLNQLLTTCPITSSQQGVLLTLPAPATVLPRHKPLPTPKPPTKWELFARKKGIGRFSGKAGAGLEDKERRKKLVYDEEKGEWVPRWGYKGKNKSDDDWLVEVNEKDWKKEEEAAAKGSSIRGMSRAERKDRIRRNERKMRANQRNSRKSGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.28
4 0.32
5 0.38
6 0.41
7 0.41
8 0.49
9 0.52
10 0.58
11 0.57
12 0.55
13 0.52
14 0.49
15 0.45
16 0.41
17 0.36
18 0.3
19 0.22
20 0.24
21 0.24
22 0.22
23 0.22
24 0.18
25 0.18
26 0.17
27 0.17
28 0.14
29 0.11
30 0.11
31 0.11
32 0.11
33 0.12
34 0.11
35 0.13
36 0.15
37 0.16
38 0.17
39 0.19
40 0.21
41 0.21
42 0.22
43 0.25
44 0.26
45 0.26
46 0.25
47 0.24
48 0.23
49 0.21
50 0.22
51 0.17
52 0.17
53 0.16
54 0.17
55 0.16
56 0.15
57 0.13
58 0.11
59 0.1
60 0.08
61 0.09
62 0.08
63 0.07
64 0.09
65 0.11
66 0.12
67 0.13
68 0.12
69 0.15
70 0.15
71 0.14
72 0.13
73 0.12
74 0.1
75 0.09
76 0.08
77 0.05
78 0.05
79 0.05
80 0.07
81 0.09
82 0.14
83 0.15
84 0.18
85 0.21
86 0.22
87 0.27
88 0.34
89 0.42
90 0.46
91 0.54
92 0.57
93 0.61
94 0.62
95 0.62
96 0.56
97 0.51
98 0.48
99 0.5
100 0.5
101 0.51
102 0.52
103 0.51
104 0.52
105 0.49
106 0.47
107 0.42
108 0.4
109 0.35
110 0.33
111 0.33
112 0.29
113 0.27
114 0.23
115 0.19
116 0.15
117 0.14
118 0.16
119 0.18
120 0.22
121 0.28
122 0.29
123 0.3
124 0.32
125 0.35
126 0.4
127 0.44
128 0.48
129 0.46
130 0.49
131 0.49
132 0.47
133 0.44
134 0.37
135 0.26
136 0.21
137 0.18
138 0.15
139 0.18
140 0.21
141 0.28
142 0.36
143 0.45
144 0.51
145 0.58
146 0.59
147 0.57
148 0.62
149 0.58
150 0.53
151 0.45
152 0.38
153 0.3
154 0.3
155 0.27
156 0.2
157 0.23
158 0.19
159 0.19
160 0.22
161 0.24
162 0.24
163 0.3
164 0.34
165 0.34
166 0.36
167 0.38
168 0.35
169 0.33
170 0.3
171 0.25
172 0.22
173 0.16
174 0.13
175 0.13
176 0.16
177 0.22
178 0.3
179 0.38
180 0.43
181 0.51
182 0.59
183 0.67
184 0.73
185 0.78
186 0.8
187 0.82
188 0.86
189 0.89
190 0.89
191 0.89
192 0.9
193 0.9
194 0.91
195 0.91
196 0.9
197 0.91
198 0.92
199 0.87