Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6YSG9

Protein Details
Accession A0A5N6YSG9    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
36-56EIFNRKVKQLQKDRAARKVQEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
Amino Acid Sequences MSLRQIFRPTVFSPRTFTYSATRTYASQTTGSPVLEIFNRKVKQLQKDRAARKVQESRKTDYIKDEVALRLCERLLDIKRDIPNVLDLGANSCNIARALTMPDIDPVNPNSPPLATRISNLTCVDTSHALLHRDADEPFNKDISITREVIPDLETLPYQPNTFDAVLSSLSIHWINDLPSLLAQVNSILKPDCPFIAAMFGGDTLFELRTSLQLADLERRGGVSPHVSPLADVRDVGGLLNKAGFKMLTVDVEDIVVEYPDTFALMQDLQSMGENNAILHRELGPISRDVLLANEAIYRALHKEEESRGIPATFRLIYMIGWKEGKDQAQPLARGSGEVNLKDILGGGDFPNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.41
4 0.41
5 0.38
6 0.38
7 0.4
8 0.38
9 0.35
10 0.31
11 0.35
12 0.36
13 0.31
14 0.29
15 0.25
16 0.26
17 0.27
18 0.26
19 0.21
20 0.18
21 0.17
22 0.2
23 0.23
24 0.22
25 0.29
26 0.29
27 0.31
28 0.37
29 0.42
30 0.49
31 0.56
32 0.62
33 0.63
34 0.72
35 0.78
36 0.8
37 0.81
38 0.75
39 0.74
40 0.74
41 0.73
42 0.72
43 0.7
44 0.68
45 0.69
46 0.69
47 0.61
48 0.57
49 0.53
50 0.45
51 0.41
52 0.37
53 0.32
54 0.31
55 0.3
56 0.24
57 0.22
58 0.2
59 0.19
60 0.17
61 0.21
62 0.22
63 0.25
64 0.27
65 0.32
66 0.35
67 0.36
68 0.36
69 0.29
70 0.28
71 0.23
72 0.21
73 0.15
74 0.12
75 0.13
76 0.13
77 0.12
78 0.1
79 0.09
80 0.1
81 0.09
82 0.09
83 0.06
84 0.07
85 0.1
86 0.11
87 0.12
88 0.11
89 0.13
90 0.14
91 0.14
92 0.15
93 0.14
94 0.16
95 0.15
96 0.15
97 0.14
98 0.14
99 0.14
100 0.15
101 0.17
102 0.14
103 0.15
104 0.21
105 0.21
106 0.24
107 0.24
108 0.23
109 0.19
110 0.19
111 0.2
112 0.15
113 0.15
114 0.14
115 0.16
116 0.16
117 0.16
118 0.17
119 0.16
120 0.16
121 0.16
122 0.17
123 0.17
124 0.19
125 0.19
126 0.18
127 0.17
128 0.15
129 0.17
130 0.19
131 0.2
132 0.18
133 0.18
134 0.19
135 0.19
136 0.19
137 0.17
138 0.13
139 0.1
140 0.09
141 0.08
142 0.08
143 0.1
144 0.1
145 0.1
146 0.09
147 0.1
148 0.12
149 0.12
150 0.11
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.05
157 0.06
158 0.07
159 0.06
160 0.06
161 0.06
162 0.07
163 0.07
164 0.07
165 0.06
166 0.06
167 0.07
168 0.07
169 0.06
170 0.06
171 0.06
172 0.07
173 0.07
174 0.08
175 0.07
176 0.08
177 0.08
178 0.09
179 0.08
180 0.07
181 0.08
182 0.07
183 0.08
184 0.08
185 0.07
186 0.06
187 0.06
188 0.05
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.05
197 0.07
198 0.07
199 0.07
200 0.08
201 0.09
202 0.13
203 0.13
204 0.13
205 0.12
206 0.12
207 0.12
208 0.11
209 0.11
210 0.11
211 0.11
212 0.13
213 0.14
214 0.13
215 0.13
216 0.14
217 0.16
218 0.13
219 0.12
220 0.11
221 0.1
222 0.1
223 0.1
224 0.1
225 0.07
226 0.07
227 0.1
228 0.09
229 0.08
230 0.09
231 0.08
232 0.07
233 0.1
234 0.1
235 0.09
236 0.11
237 0.11
238 0.11
239 0.11
240 0.11
241 0.08
242 0.07
243 0.06
244 0.05
245 0.04
246 0.04
247 0.04
248 0.05
249 0.04
250 0.04
251 0.06
252 0.06
253 0.06
254 0.07
255 0.08
256 0.08
257 0.08
258 0.09
259 0.08
260 0.09
261 0.09
262 0.08
263 0.11
264 0.11
265 0.11
266 0.11
267 0.12
268 0.12
269 0.12
270 0.14
271 0.14
272 0.14
273 0.15
274 0.15
275 0.15
276 0.13
277 0.14
278 0.13
279 0.11
280 0.1
281 0.09
282 0.09
283 0.09
284 0.09
285 0.09
286 0.1
287 0.12
288 0.12
289 0.13
290 0.18
291 0.21
292 0.28
293 0.28
294 0.28
295 0.28
296 0.28
297 0.27
298 0.23
299 0.24
300 0.18
301 0.16
302 0.16
303 0.14
304 0.14
305 0.2
306 0.21
307 0.2
308 0.21
309 0.21
310 0.24
311 0.28
312 0.3
313 0.28
314 0.29
315 0.32
316 0.39
317 0.4
318 0.37
319 0.37
320 0.34
321 0.31
322 0.29
323 0.28
324 0.26
325 0.25
326 0.25
327 0.21
328 0.21
329 0.2
330 0.2
331 0.14
332 0.09
333 0.1