Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6UHD2

Protein Details
Accession A0A5N6UHD2    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
350-371ESDSGRPGRRLNRGRKHLAFLEHydrophilic
NLS Segment(s)
PositionSequence
110-132AKKAFSAKRTKLDKAETSRKRRK
160-176AKKQSKSALGKSSKPKP
316-321ERKALK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR037647  HIRIP3  
Amino Acid Sequences MAPRRRVVSDSESESDEPVAPSVPSDDALEKALRDTVAKVYKSGNMEELTVKRVRTAAEKALGVDGGFFKGSSTWKSKSDQIIKDEVEVQDKRAQEPESDQEPEEPAPPAKKAFSAKRTKLDKAETSRKRRKTSTPEPEEQSEASASLDDASEEEVQKPAKKQSKSALGKSSKPKPSKEQLSDDSTDIKDQNDEVPPSEETEEPKNDRGEDSESEMSVVIDEEPKPTRKRQRSTGTEGSTQKGKKKTTTSKGKDADLDPDQKKIKELQDLLVKCGIRKLWWRLLAPYETSKEKIGHLEGMLREAGMTGPLKGKEAERKALKIRERRELQADVVSCQEEVKLYGKDGADEESDSGRPGRRLNRGRKHLAFLEDDGEETD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.3
4 0.23
5 0.17
6 0.16
7 0.12
8 0.12
9 0.13
10 0.12
11 0.12
12 0.13
13 0.14
14 0.14
15 0.17
16 0.18
17 0.16
18 0.16
19 0.17
20 0.15
21 0.15
22 0.16
23 0.22
24 0.28
25 0.29
26 0.29
27 0.3
28 0.34
29 0.36
30 0.36
31 0.32
32 0.25
33 0.26
34 0.29
35 0.28
36 0.28
37 0.28
38 0.26
39 0.23
40 0.24
41 0.24
42 0.25
43 0.29
44 0.31
45 0.33
46 0.33
47 0.33
48 0.32
49 0.31
50 0.24
51 0.2
52 0.14
53 0.11
54 0.1
55 0.09
56 0.08
57 0.1
58 0.13
59 0.16
60 0.21
61 0.24
62 0.27
63 0.31
64 0.37
65 0.44
66 0.52
67 0.53
68 0.51
69 0.55
70 0.52
71 0.51
72 0.48
73 0.4
74 0.37
75 0.32
76 0.3
77 0.28
78 0.28
79 0.27
80 0.28
81 0.28
82 0.22
83 0.26
84 0.29
85 0.29
86 0.3
87 0.29
88 0.26
89 0.27
90 0.26
91 0.23
92 0.19
93 0.17
94 0.17
95 0.18
96 0.18
97 0.17
98 0.2
99 0.26
100 0.33
101 0.4
102 0.48
103 0.53
104 0.6
105 0.66
106 0.66
107 0.65
108 0.63
109 0.61
110 0.6
111 0.65
112 0.65
113 0.7
114 0.75
115 0.77
116 0.77
117 0.75
118 0.76
119 0.75
120 0.77
121 0.77
122 0.76
123 0.74
124 0.71
125 0.68
126 0.6
127 0.5
128 0.4
129 0.29
130 0.21
131 0.14
132 0.1
133 0.08
134 0.06
135 0.06
136 0.04
137 0.04
138 0.06
139 0.07
140 0.08
141 0.08
142 0.1
143 0.11
144 0.13
145 0.15
146 0.21
147 0.28
148 0.28
149 0.32
150 0.37
151 0.47
152 0.51
153 0.54
154 0.55
155 0.52
156 0.57
157 0.61
158 0.63
159 0.6
160 0.59
161 0.57
162 0.55
163 0.6
164 0.63
165 0.61
166 0.58
167 0.54
168 0.55
169 0.53
170 0.46
171 0.4
172 0.31
173 0.27
174 0.2
175 0.16
176 0.11
177 0.1
178 0.12
179 0.12
180 0.12
181 0.12
182 0.14
183 0.14
184 0.15
185 0.16
186 0.14
187 0.13
188 0.17
189 0.19
190 0.19
191 0.22
192 0.22
193 0.21
194 0.2
195 0.2
196 0.2
197 0.18
198 0.21
199 0.18
200 0.17
201 0.17
202 0.17
203 0.15
204 0.11
205 0.1
206 0.05
207 0.06
208 0.06
209 0.08
210 0.11
211 0.16
212 0.19
213 0.26
214 0.36
215 0.44
216 0.51
217 0.58
218 0.66
219 0.69
220 0.75
221 0.76
222 0.7
223 0.68
224 0.63
225 0.56
226 0.52
227 0.47
228 0.44
229 0.42
230 0.4
231 0.39
232 0.47
233 0.55
234 0.59
235 0.68
236 0.68
237 0.72
238 0.72
239 0.69
240 0.63
241 0.54
242 0.5
243 0.44
244 0.46
245 0.37
246 0.39
247 0.4
248 0.36
249 0.36
250 0.36
251 0.35
252 0.34
253 0.35
254 0.34
255 0.4
256 0.4
257 0.41
258 0.4
259 0.36
260 0.28
261 0.3
262 0.25
263 0.2
264 0.27
265 0.32
266 0.36
267 0.42
268 0.44
269 0.44
270 0.48
271 0.47
272 0.43
273 0.4
274 0.35
275 0.32
276 0.32
277 0.32
278 0.28
279 0.27
280 0.27
281 0.24
282 0.23
283 0.21
284 0.25
285 0.22
286 0.23
287 0.21
288 0.17
289 0.15
290 0.12
291 0.12
292 0.09
293 0.09
294 0.09
295 0.13
296 0.14
297 0.15
298 0.17
299 0.21
300 0.28
301 0.33
302 0.41
303 0.42
304 0.47
305 0.54
306 0.61
307 0.65
308 0.64
309 0.65
310 0.67
311 0.67
312 0.66
313 0.65
314 0.6
315 0.54
316 0.51
317 0.46
318 0.37
319 0.34
320 0.29
321 0.23
322 0.2
323 0.17
324 0.11
325 0.13
326 0.15
327 0.15
328 0.15
329 0.2
330 0.2
331 0.21
332 0.22
333 0.22
334 0.19
335 0.19
336 0.19
337 0.17
338 0.17
339 0.17
340 0.19
341 0.2
342 0.22
343 0.28
344 0.34
345 0.42
346 0.52
347 0.62
348 0.7
349 0.76
350 0.83
351 0.82
352 0.81
353 0.76
354 0.71
355 0.64
356 0.55
357 0.49
358 0.39